Patents Assigned to Cilag GmbH International
  • Patent number: 11350961
    Abstract: A surgical instrument for use during a surgical procedure includes an instrument body, an ultrasonic transducer assembly extending along a longitudinal axis, a power cord, and a transducer slip joint. The ultrasonic transducer assembly is rotatably mounted within the instrument body about the longitudinal axis and defines a first outer profile. The power cord projects from the instrument body to provide electrical power to the ultrasonic transducer assembly for operating an acoustic waveguide. The transducer slip joint is positioned between the power cord and the ultrasonic transducer assembly and electrically and mechanically connects the power cord to the ultrasonic transducer assembly. The ultrasonic transducer assembly selectively rotates relative to the power cord for inhibiting the power cord from winding upon rotation of the ultrasonic transducer assembly. The transducer slip joint also defines a second outer profile that fits within the first outer profile of the ultrasonic transducer assembly.
    Type: Grant
    Filed: July 2, 2020
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Eric Roberson, James E. Borgelt, Douglas E. McCartin
  • Patent number: 11350934
    Abstract: A surgical stapling system is disclosed. In various embodiments, the system comprises a staple cartridge attachment portion, a first staple cartridge configured to be operably attached to the cartridge attachment portion, wherein the first cartridge comprises a plurality of first staples comprising first staple legs, and a second staple cartridge configured to be operably attached to the cartridge attachment portion in lieu of the first cartridge, wherein the second cartridge comprises a plurality of second staples comprising second staple legs, and wherein the second staples are different than the first staples. The system further comprises an anvil comprising a tissue-engaging surface and a plurality of forming pockets defined in the surface, wherein each pocket comprises a first landing zone configured to receive a leg of a first staple of the first cartridge and a second landing zone configured to receive a leg of a second staple of the second cartridge.
    Type: Grant
    Filed: January 17, 2020
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Gregory J. Bakos, Frederick E. Shelton, IV, Jason L. Harris, Jerome R. Morgan
  • Patent number: 11351267
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Grant
    Filed: June 15, 2020
    Date of Patent: June 7, 2022
    Assignee: Cilag GMBH International
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Patent number: 11350843
    Abstract: A powered surgical cutting and stapling instrument is disclosed. The instrument includes at least one sensor to measure at least one parameter associated with the instrument, at least one processor, and a memory operatively associated with the processor. The memory includes machine executable instructions that when executed by the processor cause the processor to monitor the at least one sensor over a predetermined time period and determine a rate of change of the measured parameter.
    Type: Grant
    Filed: September 25, 2019
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Frederick E. Shelton, IV, Jason L. Harris, Brett E. Swensgard, Richard L. Leimbach, Shane R. Adams, Mark D. Overmyer
  • Patent number: 11350978
    Abstract: An energy module is disclosed. The energy module includes a control circuit and a two wire interface coupled to the control circuit. The two wire interface is configured as a power source and as a communication interface between the energy module and a neutral electrode.
    Type: Grant
    Filed: September 5, 2019
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Joshua Henderson, Joshua P. Morgan, Andrew W. Carroll, Jeffrey L. Aldridge, Eitan T. Wiener, James M. Vachon
  • Patent number: 11350938
    Abstract: A surgical instrument comprising an RFID system is disclosed. A staple cartridge of the surgical instrument comprises one or more RFID tags which are detectable by one or more RFID readers in the surgical instrument.
    Type: Grant
    Filed: June 30, 2019
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Frederick E. Shelton, IV, Shane R. Adams, Nicholas J. Ross
  • Patent number: 11350959
    Abstract: A method of fabricating an ultrasonic medical device is presented. The method includes machining a surgical tool from a flat metal stock, contacting a face of a first transducer with a first face of the surgical tool, and contacting a face of a second transducer with an opposing face of the surgical tool opposite the first transducer. The first and second transducers are configured to operate in a D31 mode with respect to the longitudinal portion of the surgical tool. Upon activation, the first transducer and the second transducer are configured to induce a standing wave in the surgical tool and the induced standing wave comprises a node at a node location in the surgical tool and an antinode at an antinode location in the surgical tool.
    Type: Grant
    Filed: August 17, 2017
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Jeffrey D. Messerly, Brian D. Black, William A. Olson, Frederick Estera, William E. Clem, Jerome R. Morgan, Jeffrey L. Aldridge, Stephen M. Leuck
  • Patent number: 11350935
    Abstract: A surgical tool assembly that includes a surgical end effector that has first and second jaws that are movable between a fully open position and a fully closed position relative to each other. A proximal closure member is configured to move through a first closure stroke distance upon application of a closure input motion thereto. A closure reduction linkage operably interfaces with the proximal closure member and a distal closure member such that when the proximal closure member moves through the first closure stroke distance, the closure reduction linkage causes the distal closure member to axially move through a second closure stroke distance that is less than the first closure stroke distance.
    Type: Grant
    Filed: March 10, 2020
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Frederick E. Shelton, IV, Jason L. Harris
  • Patent number: 11350960
    Abstract: A surgical instrument includes a reusable assembly having an inner tube and an ultrasonic blade positioned within the inner tube. The inner tube includes at least one opening to receive a sterilization fluid therethrough for sterilizing the ultrasonic blade within the inner tube. The surgical instrument further includes a sterilization detection system to determine whether the reusable assembly has been sterilized during a sterilization cycle. A seal is selectively couplable with the at least one opening of the inner tube to fluidly seal the at least one opening for inhibiting bodily fluid from entering the at least one opening during a surgical procedure.
    Type: Grant
    Filed: April 30, 2019
    Date of Patent: June 7, 2022
    Assignee: Cilag GmbH International
    Inventors: Stephen M. Leuck, Ellen Burkart, Diana M. Castillo Sanchez, Andrew W. Carroll, Sean P. Conlon, Rafael J. Ruiz Ortiz, Demetrius N. Harris, Patrick J. Minnelli
  • Patent number: 11344303
    Abstract: A method for assessing performance of a surgical instrument including one or more drivetrains is disclosed. The method includes sensing via one or more vibration sensors vibrations generated during operation of the one or more drivetrains of the surgical instrument, generating an output signal based on the sensed vibrations, filtering the output signal to generate a filtered signal of the sensed vibrations from the one or more drivetrains, processing the filtered signal to generate a processed signal of the sensed vibrations from the one or more drivetrains, and comparing predetermined threshold values for each of an acceptable status, a marginal status, and a critical status of the surgical instrument to corresponding values of the processed signal.
    Type: Grant
    Filed: September 11, 2019
    Date of Patent: May 31, 2022
    Assignee: Cilag GmbH International
    Inventors: Frederick E. Shelton, IV, Mark D. Overmyer, David C. Yates, Jason L. Harris
  • Patent number: 11344362
    Abstract: Aspects of the present disclosure are presented for a medical instrument configured to adjust the power level for sealing procedures to account for changes in tissue impedance levels over time. In some aspects, a medical instrument may be configured to apply power according to a power algorithm to seal tissue by applying a gradually lower amount of power over to time as the tissue impedance level begins to rise out of the “bathtub region,” which is the time period during energy application where the tissue impedance is low enough for electrosurgical energy to be effective for sealing tissue. In some aspects, the power is then cut once the tissue impedance level exceeds the “bathtub region.” By gradually reducing the power, a balance is achieved between still applying an effective level of power for sealing and prolonging the time in which the tissue impedance remains in the “bathtub region.
    Type: Grant
    Filed: August 5, 2019
    Date of Patent: May 31, 2022
    Assignee: Cilag GmbH International
    Inventors: David C. Yates, Amy M. Krumm, Mark A. Davison
  • Patent number: 11344326
    Abstract: A method of determining instability of an ultrasonic blade includes monitoring a phase angle ? between voltage Vg(t) and current Ig(t) signals applied to an ultrasonic transducer, coupled to an ultrasonic blade via an ultrasonic waveguide, inferring the blade temperature based on the phase angle ?, comparing the inferred temperature to an ultrasonic blade instability trigger point threshold, and adjusting a power level applied to the ultrasonic transducer to modulate the temperature of the blade. The method may also include determining a frequency/temperature relationship of an ultrasonic blade that exhibits a displacement or modal instability and compensating for a thermal induced instability of the ultrasonic blade. The method may be implemented in an ultrasonic surgical instrument or by a control circuit in a power generator for the ultrasonic surgical instrument.
    Type: Grant
    Filed: September 27, 2018
    Date of Patent: May 31, 2022
    Assignee: Cilag GmbH International
    Inventors: Craig N. Faller, Madeleine C. Jayme, Cameron R. Nott
  • Patent number: 11344299
    Abstract: A surgical stapler. The surgical stapler includes a drive system, an electric motor, a battery and a control system. The drive system includes an actuation member. The electric motor is mechanically coupled to the drive system. The battery is electrically couplable to the electric motor. The control system includes an H-bridge circuit electrically couplable to the electric motor. The control system is configured to control the electric motor based on a sensed parameter associated with the electric motor, a position of the actuation member and a velocity of the actuation member.
    Type: Grant
    Filed: December 31, 2019
    Date of Patent: May 31, 2022
    Assignee: Cilag GmbH International
    Inventors: David C. Yates, Frederick E. Shelton, IV, Mark D. Overmyer, Shane R. Adams, Jason L. Harris
  • Patent number: 11337691
    Abstract: A surgical instrument for treating the stomach tissue of a patient is disclosed. The surgical instrument comprises a handle comprising a display, a shaft extending from the handle, and an end effector extending from said shaft. The surgical system comprises a tissue treatment system configured to treat the stomach tissue along a path, an imaging system configured to capture a tissue image of the stomach tissue, and a controller configured to determine an edge of the stomach tissue, generate an image representing at least a portion of the edge of the stomach tissue, and display the image along with at least a portion of the tissue image on the display.
    Type: Grant
    Filed: December 21, 2017
    Date of Patent: May 24, 2022
    Assignee: Cilag GmbH International
    Inventors: Tamara Widenhouse, David C. Yates, Frederick E. Shelton, IV, Jason L. Harris
  • Patent number: 11337698
    Abstract: A surgical stapling apparatus is disclosed which comprises cartridge body and a layer. The layer is implantable against tissue by staples deployed from the cartridge body and deformed by an anvil. The cartridge and the layer comprise co-operating features which reduce relative movement between the cartridge and the layer. Such co-operating features can also releasably retain the layer to the cartridge body. In addition to or in lieu of the above, the anvil and the layer comprise co-operating features which reduce relative movement between the anvil and the layer. Such co-operating features can also releasably retain the layer to the anvil. In certain instances, the layer can be positioned against the anvil, but releasably attached to the cartridge. The layer can comprise buttress material and/or a tissue thickness compensator, for example.
    Type: Grant
    Filed: March 12, 2020
    Date of Patent: May 24, 2022
    Assignee: Cilag GmbH International
    Inventors: Chester O. Baxter, III, Jerome R. Morgan, Frederick E. Shelton, IV
  • Patent number: 11337746
    Abstract: An ultrasonic device may include an electromechanical ultrasonic system defined by a predetermined resonant frequency, the electromechanical ultrasonic system including an ultrasonic transducer coupled to an ultrasonic blade. A method of controlling energy delivered to the ultrasonic device may include determining an impedance of the ultrasonic transducer during a transection process, analyzing the impedance of the ultrasonic transducer, profiling the ultrasonic blade based on the impedance, and adjusting a power delivered to the transducer during the transection process based on the profile of the blade. The method may further include pulsing, the power delivered to the ultrasonic transducer, determining changes in tissue characteristics of tissue located in an end effector, wherein the changes in tissue characteristics is determined between pulses, and adjusting power delivered to the ultrasonic transducer based on the tissue changes throughout the transection.
    Type: Grant
    Filed: September 27, 2018
    Date of Patent: May 24, 2022
    Assignee: Cilag GmbH International
    Inventor: Chad P. Boudreaux
  • Patent number: 11337747
    Abstract: A system for use with a surgical instrument includes an end effector, a memory circuit to store computer-executable instructions, and a processor. The end effector comprises a cutting member and a load cell sensor configured to sense a measure of force used to advance the cutting member through captured tissue. The processor is configured to execute the computer-executable instructions to initiate a first treatment cycle, access the measure of force used during the first treatment cycle to advance the cutting member through the captured tissue, determine that the measure of force exceeds a predetermined threshold, and generate an alert to a user of the surgical instrument based on the determination that a value of the measure of force exceeds the predetermined threshold. The predetermined threshold is based on an accumulation of biological material on the cutting member and a normal operational parameter of the first treatment cycle.
    Type: Grant
    Filed: March 8, 2018
    Date of Patent: May 24, 2022
    Assignee: Cilag GmbH International
    Inventors: Aaron C. Voegele, Phillip H. Clauda, Kevin L. Houser, Robert A. Kemerling, Mark A. Davison, Gregory A. Trees
  • Patent number: 11337693
    Abstract: A staple cartridge comprising a cartridge body, staples, and a sled is disclosed. The cartridge body comprises a longitudinal slot separating the cartridge body into a first lateral side and a second lateral side. The cartridge body further comprises a first longitudinal row of staple cavities defined in the first lateral side and a second longitudinal row of staple cavities defined in the first lateral side. The staple cavities of the first longitudinal row of staple cavities are angled toward the longitudinal slot. Gaps are present between the staple cavities in the first longitudinal row of staple cavities. The staple cavities of the second longitudinal row of staple cavities are angled toward the longitudinal slot. The staple cavities of the second longitudinal row of staple cavities are laterally aligned with the gaps. The staples are removably stored in the first and second longitudinal rows of staple cavities.
    Type: Grant
    Filed: February 27, 2020
    Date of Patent: May 24, 2022
    Assignee: Cilag GmbH International
    Inventors: Christopher J. Hess, William B. Weisenburgh, II, Carl J. Shurtleff
  • Patent number: 11337694
    Abstract: A surgical end effector for use with a surgical instrument that includes an elongate shaft assembly that includes a rotary output drive shaft is disclosed. An elongate channel is attached to the elongate shaft assembly. An anvil frame that comprises a proximal end and a distal end is selectively movable between open and closed positions relative to the elongate channel. An anvil concentric drive member is rotatably supported by the anvil frame and is configured to receive rotary drive motions from the rotary output drive shaft of the surgical instrument when the anvil frame is in the closed position. A firing member is in driving engagement with the anvil concentric drive member for linear travel through the end effector.
    Type: Grant
    Filed: January 2, 2020
    Date of Patent: May 24, 2022
    Assignee: Cilag GmbH International
    Inventors: Jerome R. Morgan, Frederick E. Shelton, IV, Jason L. Harris
  • Patent number: D953522
    Type: Grant
    Filed: November 4, 2019
    Date of Patent: May 31, 2022
    Assignee: CILAG GMBH INTERNATIONAL
    Inventor: Gregory George Scott