Abstract: A method for magnetic resonance imaging (MRI) comprises applying a consecutive series of MRI sequences to a target volume (V) according to experimental settings (TR, ?, ?). A discrete sequence of transient response signals (Sn, Sn+1, Sn+2) is measured and fitted to a fit function (F) that is continuously dependent on a sequence number (n) of the respective MRI sequence (Pn) and corresponding response signal (Sn). A shape of the fit function is determined according to an analytically modelled evolution by the experimental parameters (TR, ?, ?) as well as variable intrinsic parameters (r, ?3, ?, ?) to be fitted. For example, the model is based on an equivalent harmonic oscillator. The intrinsic parameters of the fit function can be related to the intrinsic properties (PD, T1, T2) of the spin systems and used for imaging the target volume (V). Various optimizations of contrast can be achieved by tuning the experimental settings according to the model.

Abstract: The present invention is directed to antisense oligomeric compounds that may be used in the treatment Pompe disease as well as method for modulating the splicing of the GAA gene and method to treat Pompe disease. Also pharmaceutical compositions comprising the antisense oligomeric compounds are part of the invention.

Abstract: The present invention relates to a method for determining or predicting the response of a patient diagnosed with non-small-cell lung carcinoma to targeted pharmacotherapy. The present invention also aims to provide methods and devices for predicting the response of patients diagnosed with non-small-cell lung carcinoma to specific medicaments. More specifically, the present invention provides methods which measure kinase-activity by studying phosphorylation levels and profiles and inhibitions thereof by drugs in blood samples of said patients.

Abstract: A catheter-based imaging apparatus comprises a catheter having a proximal end and a distal end. An optical emitter is configured to emit optical excitation signals from a distal portion of the catheter. One or more ultrasound transducers are configured for: (a) transmission of acoustic excitation signals from the distal portion of the catheter; and (b) detection of ultrasound response signals from an object of interest at or near to the distal portion of the catheter at frequencies which include a lower receive frequency at least as low as 10 MHz and a higher receive frequency at least as high as 35 MHz. The one or more ultrasound transducers are thereby configured to detect response signals comprising photoacoustic response signals from the object of interest at the lower receive frequency and high resolution imaging signals from the object of interest at the higher receive frequency.

Abstract: The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.

Abstract: The invention provides novel immunogenic peptides derived from the X protein and polymerase protein of hepatitis B virus (HBV). The peptides contain epitopes that are well-conserved across multiple HBV variants and are derived from regions of proteins that are essential for viral replication. Moreover, the novel HBV antigens bind multiple HLA types and epitopes that elicit IFN? responses in PBMCs from HBV resolvers have been identified.

Abstract: Method and contact lens (3) for measuring a subject's three dimensional eye movement including torsional movement. A video camera (1) is provided for recording an image of the subject's eye (2). The contact lens (3) is provided for placement over the subject's eye (2). The contact lens (3) comprises one or more markers (3a,3b) that are detectable by the video camera (1) and are positioned at a lateral offset (D) with respect to a central part (3p) of the contact lens (3). The one or more markers (3a,3b) are configured for detecting torsional rotation (R) of the subject's eye (2) around a line of sight axis (C) of the subject's eye (2) by using the video camera (1) to track a position of the one or more markers (3a,3b).

Abstract: The invention relates to the field of minimal residual disease (MRD) diagnostics, which is progressively more applied for the evaluation of treatment effectiveness in patients with a hematological malignancy, such as B-cell precursor acute lymphoblastic leukemia (BCP-ALL), B-cell chronic lymphocytic leukemia (B-CLL), and multiple myeloma (MM). Provided are unique reagent compositions with carefully selected and thoroughly tested combinations of antibodies, for ?8-color flow cytometric stainings as well as for 10-color and 12-color flow cyometric stainings, which can reach sensitivities of at least 10?4, even down to 10?5. Also provided are diagnostic kits and methods for detecting MRD.

Abstract: The invention relates to the field of medical diagnostics. Provided are methods and kits for determining the health status of a subject, for early detection of tissue damage, for early diagnosis and monitoring of a disease, and/or for evaluation of treatment effectiveness in a subject using circulating tissue macrophages (CTM) as a mirror of disrupted tissue homeostasis and disease.

Abstract: The present invention relates to a method of diagnosing cancer in a subject comprising detecting in the DNA of said subject at least one hypermethylated CpG island associated with said cancer, wherein an elevation in the level of methylation in said CpG island of said subject, relative to the level of methylation in said CpG island of a control subject, is indicative of said CpG island being hypermethylated.

Abstract: An optical probe, instrument, and method for measuring a tissue sample. The optical probe comprises a needle having a needle tip formed to penetrate a tissue surface and an optical waveguide arranged to transmit light through the needle; and a probe housing for holding the needle and comprising at least one of an actuator or a sensor configured to receive or generate a depth signal to determine a depth position of the needle tip relative to the tissue surface.

Abstract: The invention is in the field of cell culturing. More specifically, it is in the field of generating and expanding myogenic cells from induced pluripotent stem (i PS) cells. The invention relates inter alia to cells generated and expanded via such a method, a growth medium specifically suited for the purpose of expanding isolated myogenic cells, and methods for screening compounds on cell structures such as myotubes and myofibers.

Abstract: The invention relates to method for repairing aberrant; splicing, wherein such aberrant: splicing is caused by the presence of a natural pseudo exon, comprising blocking of either the natural cryptic 3? splice site or the natural cryptic 5? splice site of said natural pseudo exon with an antisense oligomeric compound (AON). Further, the invention comprises an antisense oligomeric compound targeting SEQ ID NO: 1 or SEQ ID NO: 171, preferably selected from the sequences of SEQ ID NO: 267-2040, sequences that are complementary to said sequences or sequences that have an identity of 80% with said sequences or the complementary sequences. The invention further envisages the use of two antisense oligomeric compounds, a first AON targeting SEQ ID NO: 1 and a second targeting AON or SEQ ID NO: 171. These AONs are specifically for use in the treatment of Pompe disease. It is an aspect of the invention that antisense therapy using the above AONs or combinations thereof is used in combination with ERT.

Abstract: According to one method, a sample with cells contains a phototagging agent. The sample is imaged to identify at least one target cell to be isolated. The identified target cell in the sample is selectively irradiated with photo-activating light for selectively activating the phototagging agent in the target cell to change its fluorescence response. The irradiated target cell is isolated from other cells in the sample based on a difference in its fluorescence response compared to non-activated phototagging agent in the other cells. Further aspects are directed to a corresponding microscope system and chemical compound for use as the phototagging agent.

Abstract: Provided is an isolated mammalian negative strand RNA virus, metapneumovirus (MPV), within the sub-family Pneumoviridae, of the family Paramyxoviridae. Also provided are isolated mammalian negative strand RNA viruses identifiable as phylogenetically corresponding or relating to the genus Metapneumovirus and components thereof. In particular, provided is a mammalian MPV, subgroups and variants thereof. Also provided are genomic nucleotide sequences of different isolates of mammalian MPV, in particular, human MPV. Disclosed is the use of the sequence information of different isolates of mammalian MPV for diagnostic and therapeutic methods. Provided are nucleotide sequences encoding the genome of an MPV or a portion thereof, including both mammalian and avian MPV. Further described are chimeric or recombinant viruses encoded by the nucleotide sequences and chimeric and recombinant mammalian MPV that comprise one or more non-native or heterologous sequences.

Abstract: The present invention relates to a method of diagnosing cancer in a subject comprising detecting in the DNA of said subject at least one hypermethylated CpG island associated with said cancer, wherein an elevation in the level of methylation in said CpG island of said subject, relative to the level of methylation in said CpG island of a control subject, is indicative of said CpG island being hypermethylated.

Abstract: The invention relates to a system for preventing and/or reducing muscle spasms and improving postural stability in a patient suffering from muscle spasm and postural instability. The system comprises an electrode configured to be positioned to stimulate a target dorsal root ganglion associated with the muscle spasm and postural instability. The system also comprises a pulse generator provided with an output port connectable to the electrode. The pulse generator includes a processor configured to generate an electric stimulation signal at the electrode while connected. Here, the electric stimulation signal stimulates the dorsal root ganglion with an electric pulse while so positioned. Further, the system comprises a user interface configured to set at least one user-specified parameter of the electric pulse.

Abstract: The invention relates to the field of virology. The invention provides an isolated essentially mammalian negative-sense single-stranded RNA virus (MPV) within the subfamily Pneumovirinae of the family Paramyxoviridae and identifiable as phylogenetically corresponding to the genus Metapneumovirus and components thereof.

Abstract: The present invention is direct to the treatment of Pompe disease by administration of an enzyme or nucleic acid encoding for said enzyme suitable for Enzyme Replacement Therapy for Pompe disease in combination with the administration of an antisense oligomeric compound that modulates the splicing of acid alpha-glucosidase (GAA) gene.

Abstract: The invention relates to a hyperthermia system for treating a patient, comprising an RF power unit, one or more RF antenna's connected to the RF power unit for generating a focused three-dimensional RF field, a controller for adjusting the RF power source and/or the one or more RF antenna's for steering the focused three-dimensional RF field; a sensor for sensing a parameter representative of the focused three-dimensional RF field; a communication environment for inputting data from the said sensor and/or additional information provided by the patient, said communication environment being capable of generating trigger signals to the controller for in use steering the focused three-dimensional RF filed in real time. The invention further relates to a method for generation a focused three-dimensional RF field.