Abstract: A nanoplasmonic resonator (NPR) comprising a metallic nanodisk with alternating shielding layer(s), having a tagged biomolecule conjugated or tethered to the surface of the nanoplasmonic resonator for highly sensitive measurement of enzymatic activity. NPRs enhance Raman signals in a highly reproducible manner, enabling fast detection of protease and enzyme activity, such as Prostate Specific Antigen (paPSA), in real-time, at picomolar sensitivity levels. Experiments on extracellular fluid (ECF) from paPSA-positive cells demonstrate specific detection in a complex bio-fluid background in real-time single-step detection in very small sample volumes.

Abstract: A solid-state energy conversion device and method of making is disclosed wherein the solid-state energy conversion device is formed through the conversion of an insulating material. In one embodiment, the solid-state energy conversion device operates as a photovoltaic device to provide an output of electrical energy upon an input of electromagnetic radiation. In another embodiment, the solid-state energy conversion device operates as a light emitting device to provide an output of electromagnetic radiation upon an input of electrical energy. In one example, the photovoltaic device is combined with a solar liquid heater for heating a liquid. In another example, the photovoltaic device is combined with a solar liquid heater for treating water.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides; polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides; Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B—in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: This invention publishes a secure group key management approach based upon N-dimensional hypersphere. After initialization, the GC admits the new members and assigns identifiers to them when there are new members joining the group, and deletes the leaving members' private information when there are members leaving the group. If a lot of members join and other members leave the group at the same time, the GC deletes the leaving members' private information, admits the new members, assigns indemnifiers to the new members, and then chooses mapping parameters, mapping each member's and its private information to the points in a multi-dimensional space. The GC calculates the central point of the hypersphere, and publishes the central point, the mapping parameter and the identifiers of leaving members if there are members leave. The group members calculate the mapping points, and then calculate the group keys.

Abstract: A catalyst for the generation of hydrogen from a small organic molecule comprises a tertiary metal composition where: the first metal is either Pt or Ru; the second metal is at least one of Pt, Ru, Au, Pd, Rh, Ir, Os, and/or Re; and Bi, primarily present in the form of an oxide or of a mixture of oxides and carbonates and in the +3 oxidation state. A portion of the first and/or second metal may be in the form of an oxide. The catalyst can be in the form of a nanoparticle and supported on an inert substrate, such as carbon. The catalyst can be used for dehydrogenation of formic acid or other small organic molecules in a liquid state at ambient pressures and at temperatures below the boiling point of the liquid. The liquid can be an aqueous solution of the small organic molecule.

Abstract: High-throughput OVJP systems and methods are provided that may use multiple flow paths having different conductances to enable deposition with relatively short lag times. A high-throughput OVJP system may include a flow tube having a cross-sectional area much larger than the diameter of one or more apertures through which source material may be expelled during deposition. Use of such a configuration may allow for deposition with reduced lag times.

Abstract: Brass alloy powder has a brass composition formed by a mixed phase of ?-phase and ?-phase, and contains 0.5 to 5.0 mass % of chromium. The chromium includes a component that is solid-solved in a mother phase of brass, and a component that is precipitated at crystal grain boundaries.

Abstract: The present invention relates to polymer composites prepared from a host polymer and particles. Specifically, this invention is concerned with the organic modification of the particles. More specifically, the particles are organically modified with at least two organic modifiers that are different and have specific chemical and physical properties.

Abstract: An organic light emitting device is provided having an emissive layer with an internal interface. The concentration of a second phosphorescent material in a second organic layer is different from the concentration of a first phosphorescent material in a first organic layer, creating the interface. The materials in the first and second organic layers may be the same or different. In addition to this interface within the emissive layer, the device has one or more features designed to mitigate failure mechanisms which may be associated with electrons or excitons passing from the cathode through the emissive layer to damage organic layers on the anode side of the emissive layer. In addition, devices are provided having an interface within the emissive layer as described above, and a lower energy emissive material on at least one side of the interface.

Abstract: Drilling fluids comprising graphenes and nanoplatelet additives and methods for production thereof are disclosed. Graphene includes graphite oxide, graphene oxide, chemically-converted graphene, and functionalized chemically-converted graphene. Derivatized graphenes and methods for production thereof are disclosed. The derivatized graphenes are prepared from a chemically-converted graphene through derivatization with a plurality of functional groups. Derivatization can be accomplished, for example, by reaction of a chemically-converted graphene with a diazonium species. Methods for preparation of graphite oxide are also disclosed.

Abstract: A method of fabricating a two-terminal semiconductor component using a trench technique is disclosed that includes forming a trench by etching an etching pattern formed on a substrate on which an active layer having impurities added is grown, forming a front metal layer on a front upper surface of the substrate by using an evaporation method or a sputtering method after removing the etching pattern, forming a metal plated layer on the front surface of the substrate on which the front metal layer is formed, polishing a lower surface of the substrate by using at least one of a mechanical polishing method and a chemical polishing method until the front metal layer is exposed, forming a rear metal layer on the polished substrate, and removing each component by using at least one of a dry etching method and a wet etching method.

Abstract: Compounds of formula (I): in which R1, R2, R3, R3?, R4, R5, R6, R6?, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, A, D, X, Y, and Z are defined in the specification. Also disclosed is a method of using one of the compounds to lower the blood cholesterol level and treat cancer, atherosclerosis, diabetes, Alzheimer's disease, and corneal arcus.

Abstract: A spectrometer includes a rigid body having a first planar face with an orientation and a second planar face with a different orientation than the first planar face. The first and second planar faces are configured to position Bragg diffraction elements, and the orientation of the first planar face and the different orientation of the second planar face are arranged to convey a predetermined spectral range of the electromagnetic radiation to non-overlapping regions of the sensor location via the diffraction elements.

Abstract: The invention provides tandem single nucleotide polymorphisms and methods for their use, for example, in diagnosing Down Syndrome.

Abstract: A device for forming diamond films includes a reactor chamber, a supporter, a vacuum pump, at least one hot filament, a first electrode and a second electrode. The supporter, the vacuum pump, the at least on hot filament, and the first and second electrodes are received in the reactor chamber. The reactor chamber includes an inlet and an outlet. The vacuum pump is connected with the rector chamber via the inlet. The hot filament includes at least one carbon nanotube wire. The carbon nanotube wire includes a plurality of carbon nanotubes.

Abstract: Devices containing a particular combination of organic compounds are provided. In particular, the devices contain twisted aryl compounds having extended conjugation (i.e., the twisted aryl is substituted with an additional aryl group) in combination with dibenzothiophene or dibenzofuran containing host materials. The organic light emitting devices may provide improved stability color, lifetime and manufacturing. Compounds containing a twisted aryl having extended conjugation are also provided.

Abstract: A methodology for using cortical signals to control a multi jointed prosthetic device for direct real-time interaction with the physical environment, including improved methods for calibration and training.

Abstract: Articles, compositions, kits, and methods relating to nanostructures, including those that can sequester molecules such as cholesterol, are provided. Certain embodiments described herein include structures having a core-shell type arrangement; for instance, a nanoparticle core may be surrounded by a shell including a material, such as a lipid bilayer, that can interact with cholesterol and/or other lipids. In some embodiments, the structures, when introduced into a subject, can sequester cholesterol and/or other lipids and remove them from circulation. Accordingly, the structures described herein may be used to diagnose, prevent, treat or manage certain diseases or bodily conditions, especially those associated with abnormal lipid levels.

Abstract: The process of the present invention is directed toward conducting highly selective, high yield post polymerization reactions on polymers to prepare functionalized polymers. An embodiment of the present invention comprises conducting click chemistry reactions on polymers. Preferably, the polymers were prepared by controlled polymerization processes. Therefore, embodiments of the present invention comprise processes for the preparation of polymers comprising conducting a click chemistry reaction on a functional group attached to a polymer, wherein the polymer has a molecular weight distribution of less than 2.0. The functional polymers may be prepared by converting an attached functional unit on the polymer thereby providing site specific functional materials, site specific functional materials comprising additional functionality, or chain extended functional materials.

Abstract: An antitheft method and system for motorcycles are provided. The antitheft method and system for motorcycles authenticate an electronic identifier when power-up of a motorcycle or engine start-up is sensed and cut off the power-up or engine start-up if the power-up or engine start-up is not authenticated. An electronic control unit can generate a theft alarm signal in case of unauthenticated power-up or engine start-up. The motorcycle engine is automatically stopped if the engine is started through an illegal method, and thus the motorcycle is prevented from being stolen. Further, a user can confirm the electronic identifier and start the motorcycle without inserting a key into a key cylinder, and thus the user can start the motorcycle easily and rapidly.