Patents Examined by James H. Alstrum-Acevedo
  • Albumin binding peptide conjugates and methods thereof
    Patent number: 11077199
    Abstract: The present invention provides a conjugate comprising an albumin binding peptide and a cargo, compositions for directing cargos to the lymphatic system, and vaccines. The methods of the invention can be used to increase an immune response, or to treat cancer or an infectious disease.
    Type: Grant
    Filed: August 9, 2018
    Date of Patent: August 3, 2021
    Assignee: Massachusetts Institute of Technology
    Inventors: Kelly Dare Moynihan, Rebecca Lynn Holden, Darrell J. Irvine, Bradley Lether Pentelute
  • Compositions and methods for modulation of immune response
    Patent number: 11065299
    Abstract: Provided herein are compositions and methods for modulation of immune response via PYRIN domain-only proteins POP1 and/or POP3. In particular, POP1 and/or POP3 are inhibited to enhance an immune response (e.g., to treat or prevent infection), or POP1 and/or POP3 are administered or activated to reduce an immune response (e.g., to treat or prevent autoimmune or inflammatory disease).
    Type: Grant
    Filed: June 18, 2019
    Date of Patent: July 20, 2021
    Assignee: Northwestern University
    Inventor: Christian Stehlik
  • Compositions and methods for treating disease associated with permeability of intestinal epithelium
    Patent number: 11058902
    Abstract: The present invention provides methods for treating disorders associated with intestinal barrier dysfunction and increased intestinal permeability. The invention involves administering an effective amount larazotide or a larazotide derivative to a subject or a patient in need thereof.
    Type: Grant
    Filed: February 12, 2018
    Date of Patent: July 13, 2021
    Assignees: 9 METERS BIOPHARMA, INC., NORTH CAROLINA STATE UNIVERSITY
    Inventors: Jay P. Madan, Anthony Blikslager, Sandeep Laumas
  • Engineered opsonin for pathogen detection and treatment
    Patent number: 11059873
    Abstract: The present invention provides for engineered molecular opsonins that may be used to bind biological pathogens or identify subclasses or specific pathogen species for use in devices and systems for treatment and diagnosis of patients with infectious diseases, blood-borne infections or sepsis. An aspect of the invention provides for mannose-binding lectin (MBL), which is an abundant natural serum protein that is part of the innate immune system. The ability of this protein lectin to bind to surface molecules on virtually all classes of biopathogens (viruses, bacteria, fungi, protozoans) make engineered forms of MBL extremely useful in diagnosing and treating infectious diseases and sepsis.
    Type: Grant
    Filed: December 4, 2019
    Date of Patent: July 13, 2021
    Assignee: PRESIDENT AND FELLOWS OF HARVARD COLLEGE
    Inventors: Michael Super, Jeffrey Charles Way, Donald E. Ingber
  • Engineered opsonin for pathogen detection and treatment
    Patent number: 11059874
    Abstract: The present invention provides for engineered molecular opsonins that may be used to bind biological pathogens or identify subclasses or specific pathogen species for use in devices and systems for treatment and diagnosis of patients with infectious diseases, blood-borne infections or sepsis. An aspect of the invention provides for mannose-binding lectin (MBL), which is an abundant natural serum protein that is part of the innate immune system. The ability of this protein lectin to bind to surface molecules on virtually all classes of biopathogens (viruses, bacteria, fungi, protozoans) make engineered forms of MBL extremely useful in diagnosing and treating infectious diseases and sepsis.
    Type: Grant
    Filed: June 4, 2020
    Date of Patent: July 13, 2021
    Assignee: PRESIDENT AND FELLOWS OF HARVARD COLLEGE
    Inventors: Michael Super, Jeffrey Charles Way, Donald E. Ingber
  • Methods and pharmaceutical compositions for the treatment of kidney cancer
    Patent number: 11052131
    Abstract: Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.
    Type: Grant
    Filed: October 4, 2017
    Date of Patent: July 6, 2021
    Assignees: INSERM (INSTITUT NATIONAL DE LA SANTÉ ET DE LA RECHERCHE MÉDICALE), UNIVERSITE DE BORDEAUX, INSTITUT BERGONIÉ
    Inventors: Géraldine Siegfried, Abdel-Majid Khatib, Jean-Luc Hoepffner, Serge Evrard
  • Therapeutic and cosmetic uses and applications of calreticulin
    Patent number: 11045521
    Abstract: The invention relates to therapeutic and cosmetic uses of calreticulin including reducing eliminating wrinkles and/or fine lines, tissue repair and reconstruction, repairing damaged and/or cartilage, stimulating regeneration of an epidermal appendage, enhancing phagocytosis of bacteria by phagocytes within a wound, treating a wound in a patient suffering delayed wound healing, treating a corneal wound, and treating or preventing a surgical adhesion.
    Type: Grant
    Filed: March 4, 2019
    Date of Patent: June 29, 2021
    Assignee: NEW YORK UNIVERSITY
    Inventors: Leslie I. Gold, Marek Michalak
  • BH4 stabilized peptides and uses thereof
    Patent number: 11046739
    Abstract: Provided herein are polypeptides containing stabilized BH4 domains of BCL-2 family proteins that are capable of binding and/or inactivating and/or modulating BAX protein, and/or its close homologues BAK and BOK, and/or other physiological BH4 targets. Also provided are compositions containing these polypeptides and methods of treating cytotoxic diseases that include administering to a subject one of the polypeptides.
    Type: Grant
    Filed: August 31, 2018
    Date of Patent: June 29, 2021
    Assignee: Dana-Farber Cancer Institute, Inc.
    Inventors: Loren D. Walensky, Michelle L. Stewart, Lauren Barclay
  • Hybrid peptidomimetics for use in neuropathic pain
    Patent number: 11041010
    Abstract: The invention pertains to novel hybrid peptidomimetics, pharmaceutical composition comprising thereof and use thereof in the treatment of neuropathic pain. The hybrid peptidomimetics according to the invention are comprised of two components: an opioid receptor agonist (OP) and a MC4 receptor antagonist, connected by a linker. The compounds of such a structure will allow to activate opioid receptors with simultaneous blocking of melanocortin type 4 receptors (MC4), which results in enhancing efficiency of the opioid therapy in neuropathic pain.
    Type: Grant
    Filed: July 3, 2018
    Date of Patent: June 22, 2021
    Assignees: Uniwersytet Warszawski, Instytut Farmakologii Polskiej Akademii Nauk
    Inventors: Aleksandra Misicka-Kesik, Ewa Witkowska, Beata Wilenska, Barbara Przewlocka, Joanna Mika, Joanna Starnowska-Sokol, Anna Piotrowska-Murzyn
  • Methods of isolating barrel-like proteases and identifying peptides processed thereby
    Patent number: 11035858
    Abstract: A method of isolating barrel-like proteases is disclosed. The method comprising isolating barrel-like proteases from a biological sample containing the barrel-like proteases under conditions that maintain the content of the barrel-like protease-processed peptides in the barrel-like proteases upon isolation. A method of isolating barrel-like protease-processed peptides and a method of identifying barrel-like protease-processed peptides are also disclosed.
    Type: Grant
    Filed: March 17, 2017
    Date of Patent: June 15, 2021
    Assignee: Yeda Research and Development Co. Ltd.
    Inventors: Yifat Merbl, Hila Wolf-Levy, Yishai Levin, Bareket Dassa
  • Compositions and methods for preventing and reducing inflammation and treating disorders associated with inflammation
    Patent number: 11026992
    Abstract: The present invention relates to compositions and methods for preventing and reducing inflammation and preventing and treating diseases and disorders associated with inflammation. It has been shown that CRADD plays a pivotal role in maintaining the integrity of endothelial monolayers. The recombinant cell-penetrating CRADD protein (CP-CRADD)-based compositions and methods described herein provide for the development of a novel treatment for inflammatory vascular disorders including cardiovascular, cerebrovascular, respiratory, gastrointestinal, and renal systems.
    Type: Grant
    Filed: June 21, 2019
    Date of Patent: June 8, 2021
    Assignee: Vanderbilt University
    Inventors: Jack J. Hawiger, Ruth Ann Veach, Yan Liu, Huan Qiao, Lukasz S. Wylezinski
  • Antibody-drug conjugate with a tubulysin analog warhead having a stabilized acetate group in the TUV subunit
    Patent number: 11020490
    Abstract: In antibody-drug conjugates having tubulysin analog as the warhead, according to formula (III) the acetate group in the Tuv subunit (dotted box) demonstrates improved stability against hydrolytic cleavage.
    Type: Grant
    Filed: June 11, 2019
    Date of Patent: June 1, 2021
    Assignee: Bristol-Myers Squibb Company
    Inventors: Ian S. Young, Sha Lou, Sanjeev Gangwar
  • Methods for treatment of diseases
    Patent number: 11020462
    Abstract: We describe peptides and their uses for the treatment of, e.g. acute myocardial infarction and other cytokine storm-associated conditions.
    Type: Grant
    Filed: August 26, 2016
    Date of Patent: June 1, 2021
    Assignee: SERPIN PHARMA
    Inventor: Cohava Gelber
  • Methods and compositions related to inhibition of viral entry
    Patent number: 11020482
    Abstract: Disclosed herein are compositions and methods for inhibiting viral entry.
    Type: Grant
    Filed: August 21, 2019
    Date of Patent: June 1, 2021
    Assignee: THE UNIVERSITY OF UTAH RESEARCH FOUNDATION
    Inventors: J. Nicholas Francis, Joseph S. Redman, Michael S. Kay
  • Compounds supports hematopoietic stem cells and red blood cells
    Patent number: 11013704
    Abstract: The present disclosure relates to methods of using a compound to induce regeneration of hematopoietic stem cells or increase the recovery of red blood cells. In some aspects, the present methods can be used to with or in place of erythropoietin in patients to mitigate the side effects of erythropoietin.
    Type: Grant
    Filed: May 12, 2015
    Date of Patent: May 25, 2021
    Assignee: The Board of Regents of the University of Texas System
    Inventors: Chengcheng Zhang, Yi Liu, Junke Zheng, Mi Deng, Chuo Chen, Jiawei Liu
  • Cartilage-homing peptide conjugates and methods of use thereof
    Patent number: 11013814
    Abstract: Peptides that home, target, migrate to, are directed to, are retained by, or accumulate in and/or bind to the cartilage or kidney of a subject are disclosed. Pharmaceutical compositions and uses for peptides or peptide-active agent complexes comprising such peptides are also disclosed. Such compositions can be formulated for targeted delivery of an active agent to a target region, tissue, structure or cell in the cartilage. Targeted compositions of the disclosure can deliver peptide or peptide-active agent complexes to target regions, tissues, structures, or cells targeted by the peptide.
    Type: Grant
    Filed: March 16, 2018
    Date of Patent: May 25, 2021
    Assignee: Blaze Bioscience, Inc.
    Inventors: Julia E. Novak, Natalie Winblade Nairn, Dennis M. Miller, Scott Presnell, Claudia Jochheim, Mark Stroud
  • Compositions comprising pregnancy specific glycoproteins and methods of use thereof
    Patent number: 11007249
    Abstract: The present invention relates to methods of treating a subject suffering from or at risk of suffering from graft versus host disease (GvHD) comprising administering a therapeutically effective amount of at least one of pregnancy specific glycoprotein 1 (PSG1) or PSG9 to a subject in need thereof.
    Type: Grant
    Filed: September 16, 2016
    Date of Patent: May 18, 2021
    Assignees: The Henry M. Jackson Foundation for the Advancement of Military Medicine, Inc., The United States of America, as represented by the Secretary, Department of Health and Human Services
    Inventors: Gabriela Dveksler, Harry Malech
  • Complement factor B analogs and their uses
    Patent number: 11001822
    Abstract: The invention provides polypeptides comprising a complement factor B analog. The invention also provides various complement factor B analogs including complement factor B analogs comprising a mutation of a free cysteine amino acid and related methods, nucleic acids and vectors. These complement factor B analogs and related methods, nucleic acids and vectors can be used to modulate a complement pathway or for the study and/or treatment of various conditions or diseases related to a complement pathway.
    Type: Grant
    Filed: May 14, 2020
    Date of Patent: May 11, 2021
    Assignee: Wellstat ImmunoTherapeutics, LLC
    Inventors: ChangHung Chen, Michael Kaleko, Beibei Li, Tianci Luo, Jeffrey Allan Miller, Ruigong Wang
  • TSLP inhibitors
    Patent number: 11001624
    Abstract: The present invention relates to monomeric fusion proteins comprising the extracellular part of the thymic stromal lymphopoietin receptor (TSLPR) and the extracellular part of the interleukin-7 receptor alpha (IL-7Ralpha) as inhibitors of thymic stromal lymphopoietin (TSLP) activity. The invention relates further to the use of said inhibitors as a medicament in the treatment of—but not limited to—inflammatory diseases, cancer and fibrosis.
    Type: Grant
    Filed: April 4, 2017
    Date of Patent: May 11, 2021
    Assignees: VIB VZW, UniversiteitGent
    Inventors: Savvas Savvides, Rudi Beyaert, Kenneth Verstraete, Harald Braun, Frank Peelman
  • Pharmaceutical preparation
    Patent number: 10995128
    Abstract: Preparations including recombinant FSH (rFSH).
    Type: Grant
    Filed: August 29, 2017
    Date of Patent: May 4, 2021
    Assignee: FERRING INTERNATIONAL CENTER SA
    Inventors: Ian Cottingham, Daniel Plaksin, Richard Boyd White