Patents Examined by Shelly Guest Cermak
-
Patent number: 5684133Abstract: The CNS myelin associated proteins inhibit neurite outgrowth in nerve cells and neuroblastoma cells, and can also inhibit fibroblast spreading. Such inhibitory proteins include a 35,000 dalton and a 250,000 dalton molecular weight protein and analogs, derivatives, and fragments thereof. The CNS myelin associated inhibitory proteins may be used in the treatment of malignant tumors. The present invention is also directed to antibodies to the CNS myelin associated proteins; such antibodies can be used in the diagnosis and therapies of nerve damage resulting from trauma, infarction, and degenerative disorders of the central nervous system. In a specific embodiment of the invention, monoclonal antibody IN-1 may be used to promote regeneration of nerve fibers over long distances in spinal cord lesions.Type: GrantFiled: August 30, 1989Date of Patent: November 4, 1997Assignee: Erziehungsdirektion of the Canton ZurichInventors: Martin E. Schwab, Pierenrico W. Caroni
-
Patent number: 5545723Abstract: A IFN-.beta. mutein in which phe (F), tyr (Y), trp (W) or his (H) is substituted for val (V) at position 101, when numbered in accordance with wild type IFN-.beta., DNA sequences encoding these IFN-.beta. muteins, recombinant DNA molecules containing those DNA sequences operatively linked to expression control sequences and capable of inducing expression of an IFN-.beta. mutein, hosts transformed with those recombinant DNA molecules, pharmaceutical compositions containing IFN-.beta. muteins and methods of using those compositions to treat viral infections, cancer or tumors or for immunomodulation.Type: GrantFiled: March 15, 1994Date of Patent: August 13, 1996Assignee: Biogen Inc.Inventors: Susan E. Goelz, Richard L. Cate, E. Pingchang Chow, R. Blake Pepinsky
-
Patent number: 5539094Abstract: The present invention provides nucleotide sequences encoding proteins and fragments thereof that bind to Bcl-2-related proteins. The invention also provides a Bcl-2-associated protein (BAP) such as Bcl-2-associated protein-1 (BAP-1), which binds to Bcl-2. The invention also provides antibodies that specifically bind to a BAP. The invention further provides methods for detecting agents such as drugs that alter the binding of a BAP such as BAP-1 or Raf-related protein with a Bcl-2-related protein and methods for detecting agents that induce dissociation of a bound complex formed by the association of a BAP and a Bcl-2-related protein. The invention further provides methods for modulating the activity of a Bcl-2-related protein in a cell by introducing into the cell a nucleic acid encoding a BAP or by introducing into the cell an antisense nucleotide sequence, which is complementary to a region of a gene encoding a BAP.Type: GrantFiled: November 12, 1993Date of Patent: July 23, 1996Assignee: La Jolla Cancer Research FoundationInventors: John C. Reed, Shinichi Takayama, Takaaki Sato
-
Patent number: 5530109Abstract: The invention relates to isolated nucleic acid molecules which encode for part or all of glial growth factor molecules, as well as recombinant vectors and transfected cell lines.Type: GrantFiled: March 24, 1993Date of Patent: June 25, 1996Assignees: Ludwig Institute For Cancer Research, Cambridge NeuroscienceInventors: Andrew Goodearl, Paul Stroobant, Luisa Minghetti, Michael Waterfield, Mark Marchioni, Mario S. Chen, Ian Hiles
-
Patent number: 5488099Abstract: Neurotrophins having activities of multiple parental neurotrophins are described, as well as DNA for their production and pharmaceutical preparations thereof.Type: GrantFiled: November 20, 1992Date of Patent: January 30, 1996Inventors: Hakan B. Persson, deceased, Carlos F. I. Moliner
-
Patent number: 5470952Abstract: Heterodimer proteins comprising a soluble .alpha. specificity determining cytokine receptor component and the extracellular domain of a .beta. receptor component function as CNTF and IL-6 antagonsists.Type: GrantFiled: October 20, 1993Date of Patent: November 28, 1995Assignee: Regeneron Pharmaceuticals, Inc.Inventors: Neil Stahl, Aris N. Economides, George D. Yancopoulos
-
Patent number: 5466783Abstract: A cDNA clone having a base sequence for human tissue factor inhibitor (TFI) has been developed and characterized and the amino acid sequence of the TFI has been determined.Type: GrantFiled: July 15, 1993Date of Patent: November 14, 1995Assignees: Monsanto Company, Washington UniversityInventors: Tze-Chein Wun, Kuniko K. Kretzmer, George J. Broze, Jr.
-
Patent number: 5464943Abstract: Disclosed are (1) a mutein of a fibroblast growth factor (FGF), the DNA having introduced therein at least one nucleotide sequence coding for a glycosylation site, (2) a DNA coding for the mutein of (1), (3) a vector containing the DNA of (2), (4) a transformant transformed with the vector of (3), and (5) a process for producing the mutein which comprises cultivating in a culture medium the transformant of a yeast or animal cell transformed with a vector of (3), and producing and accumulating the mutein of (1) in the culture medium, whereby the FGF mutein into which at least one glycosylation site has been introduced is improved in productivity, stability and activities, and advantageously used as medicine.Type: GrantFiled: July 15, 1994Date of Patent: November 7, 1995Assignee: Takeda Chemical Industries, Ltd.Inventors: Masaharu Senoo, Reiko Sasada, Koichi Igarashi
-
Patent number: 5460811Abstract: A cDNA library is constructed using mRNA from human fibroblasts induced with poly(I):poly(C). A bacterial clone containing fibroblast interferon cDNA sequences identified by hybridization to a cDNA probe synthesized using deoxyoligonucleotide primers which hybridize to fibroblast interferon mRNA specifically. Expression plasmids are constructed which permit the synthesis in E. coli of 8.times.10.sup.7 units of human fibroblast interferon per liter of culture. The bacterially produced fibroblast interferon is indistinguishable from authentic human fibroblast interferon by several critieria.Type: GrantFiled: June 12, 1989Date of Patent: October 24, 1995Assignee: Genentech, Inc.Inventors: David V. Goeddel, Roberto Crea
-
Patent number: 5455338Abstract: The present invention provides isolated DNA molecules comprising a DNA segment encoding novel human Kunitz-type inhibitors. Also provided are DNA constructs comprising a first DNA segment encoding a novel human Kunitz-type inhibitor wherein said first DNA segment is operably linked to additional DNA segments required for the expression for the first DNA segment, as well as host cells containing such DNA constructs and methods for producing proteins from the host cells.Type: GrantFiled: November 5, 1993Date of Patent: October 3, 1995Assignees: ZymoGenetics, Inc., University of New MexicoInventors: Cindy A. Sprecher, Walt Kisiel, Donald C. Foster
-
Patent number: 5451669Abstract: A receptor for the Fc portion of immunoglobulin, derived from mouse or human cells, the receptor exhibiting the ability to bind to the Fc portion of mouse and human immunoglobulin and comprising a transmembrane proteins having about 280-301 amino acids including two substantially regularly spaced pairs of Cys residues and two or four potential N-linked glycosylation sites. The present invention also provides for a nucleotide sequence, gene, cDNA clone or a vector containing same capable of encoding the above receptor.Type: GrantFiled: May 27, 1992Date of Patent: September 19, 1995Assignee: The University of MelbourneInventors: Ian F. C. McKenzie, Mark P. Hogarth, Margaret L. Hibbs, Bernadette M. Scott, Lisa Bonadonna
-
Patent number: 5444164Abstract: A new TGF-.beta. induced gene and protein is described. Treatment of TGF-.beta. growth arrested cells induces the production of a novel gene which encodes a 683 amino acid protein, designated BIG-H3, that contains four homologous repeat regions and which may represent a cell surface recognition molecule. This gene and protein is induced in mammalian cells, and specifically human cells, upon treatment with TGF-.beta., and is shown to inhibit the growth of tumor cells.Type: GrantFiled: May 4, 1992Date of Patent: August 22, 1995Assignee: Bristol-Myers Squibb CompanyInventors: Anthony F. Purchio, John E. Skonier, Michael G. Neubauer
-
Patent number: 5428010Abstract: Dimeric proteins having substantially the same biological activity as PDGF are disclosed. More specifically, the protein may have two substantially identical polypeptide chains, each of the chains being substantially homologous to the B-chain of PDGF. Alternatively, the protein may have two polypeptide chains that are substantially identical to the B-chain of PDGF. In addition, proteins comprising polypeptides that are variants or derivatives of the B-chain of PDGF are also disclosed. Therapeutic compositions containing these proteins and methods for enhancing the wound-healing process in warm- blooded animals are also disclosed.Type: GrantFiled: March 18, 1992Date of Patent: June 27, 1995Assignee: ZymoGenetics, Inc.Inventors: Mark J. Murray, James D. Kelly
-
Patent number: 5427781Abstract: A lymphokine is taught which can be used to activate and stimulate CD3.sup.+, CD4.sup.+ T cells, as well as Sezary leukemic T cells. The lymphokine can be obtained from mitogen-stimulated peripheral blood mononuclear cells or urine of Sezary Syndrome patients. The lymphokine upregulates interleukin-2 receptors.Type: GrantFiled: July 2, 1993Date of Patent: June 27, 1995Assignee: University of MiamiInventors: Elaine DeFreitas, J. Todd Abrams
-
Patent number: 5427780Abstract: Mullerian Inhibiting Substance (MIS)-like polypeptide are described. The MIS-like polypeptides are useful in the treatment of ovarian cancer and other susceptible cancers.Type: GrantFiled: October 5, 1992Date of Patent: June 27, 1995Assignees: Biogen, Inc., The General Hospital CorporationInventors: Richard L. Cate, Patricia K. Donahoe
-
Patent number: 5420243Abstract: The invention relates to peptides corresponding to regions of the amino acid sequence of TGF-.beta.1 or TGF-.beta.2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF-.beta.. The monomeric form of the peptide derived from TGF-.beta.1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1). The monomeric form of the peptide derived from TGF-.beta.2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.Type: GrantFiled: January 26, 1993Date of Patent: May 30, 1995Assignee: Celtrix Pharmaceuticals, Inc.Inventors: Yasushi Ogawa, David Schmidt
-
Patent number: 5405945Abstract: Expression constructs for the alpha subunit common to the four human reproductive hormones are disclosed which have enhanced efficiency. These constructs are characterized by the presence of only one intron interrupting the coding sequence for the alpha subunit.Type: GrantFiled: September 24, 1992Date of Patent: April 11, 1995Assignee: Washington UniversityInventors: Irving Boime, Martin M. Matzuk
-
Patent number: 5387520Abstract: Disclosed are methods and compositions for treating neuroblastoma cells. The methods include contacting the neuroblastoma cells with a neurotrophic factor and less than a lethal dose of an inhibitor of cell proliferation for about 1 to 15 days, and then maintaining the neuroblastoma cells in contact with the neurotrophic factor for an additional 1 to 15 days. The composition includes a neurotrophic factor such as the neurotropin, nerve growth factor, and an inhibitor of cell proliferation such as aphidicolin, thymidine, or hydroxyurea. Also disclosed are methods for inducing the remission or differentiation of, or eliminating, neuroblastoma cells.Type: GrantFiled: August 27, 1992Date of Patent: February 7, 1995Assignee: Worcester Foundation for Experimental BiologyInventors: Patrizia LoPresti, Wojciech Poluha, Dorota K. Poluha, Alonzo H. Ross
-
Patent number: 5376567Abstract: DNA constructs are prepared which operably link human interferon genes, selective, eukaryotic marker genes, and promoter and expression control sequences for the expression of human interferon in Chinese hamster ovary (CHO) cells or progeny thereof. The human recombinant interferon so produced contains glycans which are a subset of the population of glycans which are contained in the native counterpart, and may be used in therapeutic formulations. The CHO cells yield high levels of human interferon with no detectable amounts of host, IFN, either constitutive or inductive.Type: GrantFiled: January 9, 1992Date of Patent: December 27, 1994Assignees: Berlex Laboratories, Inc., Board of Trustees of the Leland Stanford, Jr. Univ.Inventors: Francis P. McCormick, Michael A. Innis, Gordon M. Ringold
-
Patent number: 5372808Abstract: Methods for the treatment of cell proliferation disorders, viral infections, and other conditions without causing significant side effects normally associated with interferon therapy, involving administering to a patient in need thereof a therapeutically effective amount of consensus human leukocyte interferon are disclosed. Also disclosed are pharmaceutical compositions of consensus human leukocyte interferon.Type: GrantFiled: April 15, 1992Date of Patent: December 13, 1994Assignee: Amgen Inc.Inventors: Lawrence M. Blatt, Milton W. Taylor