Patents by Inventor Fernando Albericio

Fernando Albericio has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20110060125
    Abstract: The invention relates to indolesulfonyl halogenides which are useful for the protection of organic compounds comprising at least one guanidino moiety and/or at least one amino group. The invention further relates to a process for their preparation and their use as protecting reagents. The invention also relates to the process for the protecting reaction and to the protected compounds thereof.
    Type: Application
    Filed: May 5, 2009
    Publication date: March 10, 2011
    Inventors: Matthieu Giraud, Fernando Albericio, Albert Isidro Llobet, Mercedes Alvarez Domingo
  • Publication number: 20110046349
    Abstract: Exenatide, a polypeptide having the 39 amino acid sequence H-1His-Gly-Glu-Gly-5Thr-Phe-Thr-Ser-Asp-10Leu-Ser- Lys-Gln-Met-15Glu-Glu-Glu--Ala-Val-20Arg-Leu-Phe- Ile-Glu-25Trp-Leu-Lys-Asn-Gly-30Gly-Pro-Ser-Ser- Gly-35Ala--Pro-Pro-Pro-Ser-NH2, respectively its 44-mer analogue H-1His-Gly-Glu-Gly-5Thr-Phe-Thr-Ser-Asp-10Leu-Ser- Lys-Gln-Met-15Glu-Glu-Glu--Ala-Val-20Arg-Leu-Phe- Ile-Glu-25Trp-Leu-Lys-Asn-Gly-30Gly-Pro-Ser-Ser- Gly-35Ala--Pro-Pro-Ser-Lys-40Lys-Lys-Lys-Lys-Lys- NH2 is prepared via a convergent four-fragment synthesis strategy from the fragments comprising the amino acid positions 1-10, 11-21, 22-29 and 30-39, respectively 30-44.
    Type: Application
    Filed: July 14, 2010
    Publication date: February 24, 2011
    Inventors: Matthieu Giraud, Anne-Sophie Droz, Stéphane Varray, El Djouhar Rekai, Marie-Hèléne Brichard, Daniel Latassa, Christine Devijver, Pascal Gilles, Jeanne-Marie Cauvin, Fernando Albericio, Marta Paradis Bas
  • Publication number: 20100323021
    Abstract: The present invention relates to colloidal metal nanoparticles conjugated with Kahalalide F, or an analogue thereof, and their use in the treatment of cancer. The invention also relates to a method for increasing the antitumoral activity of Kahalalide F, or an analogue thereof, which comprises conjugating the Kahalalide F, on an analogue thereof, with a colloidal metal nanoparticle.
    Type: Application
    Filed: January 30, 2009
    Publication date: December 23, 2010
    Applicant: PHARMA MAR, S.A.
    Inventors: Leticia Hosta, Mateu Pla, Luis Javier Cruz, Marcelo Kogan, Fernando Albericio
  • Publication number: 20100292163
    Abstract: Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof useful as antitumour agents.
    Type: Application
    Filed: December 10, 2008
    Publication date: November 18, 2010
    Applicant: Pharma Mar, S.A.
    Inventors: Judit Tulla-Puche, Eleonora Marcucci, Núria Bayo-Puxan, Fernando Albericio, Maria Del Carmen Cuevas Marchante
  • Publication number: 20100249370
    Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
    Type: Application
    Filed: June 30, 2008
    Publication date: September 30, 2010
    Applicant: LONZA AG
    Inventors: Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos
  • Publication number: 20100197891
    Abstract: A new method of anchoring a growing peptide chain during chemical synthesis to a solid-phase support is devised. Novel amino acid derivatives and peptide derivatives, both unbonded and bonded to a solid-phase support, are also provided.
    Type: Application
    Filed: October 3, 2007
    Publication date: August 5, 2010
    Inventors: Matthieu Giraud, Fernando Albericio, Francesca Quattrini, Oleg Werbitzky, Katja Senn, Michaela Williner
  • Publication number: 20100144588
    Abstract: Novel iminium-type coupling agents containing proton acceptors in their iminium moiety, which can be used beneficially as coupling agents in various chemical polypeptide and/or polynucleotide syntheses, and are particularly useful as yield enhancing and racemization suppressing coupling agents for use in peptide syntheses, are disclosed. Further disclosed are a process of preparing such iminium-type coupling agents and their use in the preparation of polypeptides and/or polynucleotides.
    Type: Application
    Filed: May 15, 2008
    Publication date: June 10, 2010
    Applicant: LUXEMBOURG BIO TECHNOLOGIES LTD.
    Inventors: Fernando Albericio, Ayman El-Faham, Yoav Luxembourg, Ariel Ewenson
  • Publication number: 20100129800
    Abstract: The present invention relates to a polymer composed by two to ten monomers of formula (I) as well as to a process for its preparation and its use as fluorophore wherein: X is a radical of formula (II) wherein —R5 is an electron pair or a (C1-C3)-alkyl radical; —Ra and —Rb are radicals independently selected from the group consisting of H, (C1-C4)-alKyI, (C1-C4)-alkoxy, (C1-C4)-alkylamino, phenyl, F, Cl, Br, amino, hydroxy, and nitro or —Ra and —Rb are fused forming with the carbon atoms to which they are attached a ring of formula (III) with the condition that (I) when —R5 is an electron pair, a is a N?C double bond, and Ra and Rb are fused forming the ring (III), said ring being a biradical selected from (IIIa) and (IIIb), thus, radical (II) is (IIa) or (IIb) respectively (II) when —R5 is a (C1-C3)-alkyl radical, a is a N—C single bond and Ra and Rb are fused forming the ring (III), said ring being a biradical (a), thus, the radical (II) is (IIc) R1-R4 and R7-R18 represent radicals, same or different, select
    Type: Application
    Filed: July 9, 2008
    Publication date: May 27, 2010
    Inventors: Juan Aymami Bofarull, Fernando Albericio Palomera, Anna Maria Avino Andres, Josep Farrera Sinfreu, Miriam Royo Exposito, Isabel Navarro Munoz, Ramon Eritja Casadella
  • Publication number: 20100048596
    Abstract: Antitumoural compounds of general formula (I); wherein Ar is an heterocyclic group of formula (a) and R1, R2, R3, R4, R5, R6, R7, n and the dotted line take permitted meanings can be obtained from a tunicate of the family Polyclinidae, genus Aplidium, species cyaneum, and the invention further provides derivatives thereof.
    Type: Application
    Filed: November 13, 2006
    Publication date: February 25, 2010
    Applicant: Pharma Mar, S.A.
    Inventors: Jose Fernando Reyes Benitez, Andrés Francesch Solloso, Carmen Cuevas Marchante, Marta Altuna Urquijo, Daniel Pla Queral, Mercedes Alvarez Domingo, Fernando Albericio Palomera
  • Publication number: 20090181424
    Abstract: A mammalian expression vector that is a murine CMV promoter and the first intron of the major immediate early gene of the human cytomegalovirus. There are mammalian host cells containing the expression vector. There is also a process for the production of recombinant protein by using the expression vector.
    Type: Application
    Filed: April 20, 2006
    Publication date: July 16, 2009
    Inventors: Fernando Albericio, Luis Javier Cruz, Fayna Garcia-Martin, Judit Tulla-Puche
  • Publication number: 20090171068
    Abstract: A method for solid phase synthesis of Thymosin ?1 is devised.
    Type: Application
    Filed: May 4, 2006
    Publication date: July 2, 2009
    Inventors: Fernando Albericio, Luis Javier Cruz, Yesica Garcia Ramos, Judit Tulla-Puche
  • Publication number: 20090124647
    Abstract: Antitumoural compounds of general formula (I); wherein Ar is an heterocyclic group of formula (a) and R1, R2, R3, R4, R5, R6, R7, n and the dotted line take permitted meanings can be obtained from a tunicate of the family Polyclinidae, genus Aplidium, species cyaneum, and the invention further provides derivatives thereof.
    Type: Application
    Filed: November 13, 2006
    Publication date: May 14, 2009
    Applicant: PHARMA MAR, S.A.
    Inventors: Jose Fernando Reyes Benitez, Andres Francesch Solloso, Carmen Cuevas Marchante, Marta Altuna Urquijo, Daniel Pla Queral, Mercedes Alvarez Domingo, Fernando Albericio Palomera
  • Patent number: 7531506
    Abstract: Trunkamide A and other cycloheptapeptides can be made by solid phase synthesis of a linear precursor.
    Type: Grant
    Filed: April 2, 2002
    Date of Patent: May 12, 2009
    Assignee: Pharma Mar, S.A.
    Inventors: Fernando Albericio Palomera, Josep Maria Caba Naudi, Ernest Giralt Lledó, Ignacio Manzanares, Ignacio Rodriquez
  • Patent number: 7482429
    Abstract: A process is provided for preparing kahalalide F and which leads to other kahalalide mimic compounds having useful biological activity.
    Type: Grant
    Filed: February 9, 2001
    Date of Patent: January 27, 2009
    Assignee: Pharma Mar, S.A.
    Inventors: Fernando Albericio, Ernest Giralt, Jose Carlos Jimenez, Angel Lopez, Ignacio Manzanares, Ignacio Rodrigues, Miriam Royo
  • Publication number: 20080318849
    Abstract: A process is provided for preparing kahalalide F and which leads to other kahalalide mimic compounds having useful biological activity.
    Type: Application
    Filed: August 25, 2008
    Publication date: December 25, 2008
    Applicant: PHARMA MAR, S.A.
    Inventors: Fernando Albericio, Ernest Giralt, Jose Carlos Jimenez, Angel Lopez, Ignacio Manzanares, Ignacio Rodrigues, Miriam Royo
  • Publication number: 20080269282
    Abstract: This invention is directed to inhibitors of copper-containing amine oxidases (E.C.1.4.3.6) including semicarbazide-sensitive amine oxidase (SSAO; also known as vascular adhesion protein-1, VAP-I), and their therapeutic use in inflammatory diseases, diabetes and its associated complications, atherosclerosis, neurodegenerative diseases, obesity, hypertension and cancer.
    Type: Application
    Filed: August 2, 2005
    Publication date: October 30, 2008
    Applicant: GENMEDICA THERAPEUTICS SL
    Inventors: Luc Marti Clauzel, Silvia Garcia Vicente, Francesc Yraola Font, Miriam Royo Exposito, Fernando Albericio Palomera, Antonio Zorzano Olarte
  • Publication number: 20080227809
    Abstract: This invention provides compounds and pharmaceutical compositions thereof for treating human type 1 and type 2 diabetes, particularly insulin-resistant diabetes.
    Type: Application
    Filed: July 1, 2005
    Publication date: September 18, 2008
    Applicants: GENMEDICA THERAPEUTICS SL, UNIVERSIDAD DE BARCELONA
    Inventors: Miriam Royo Exposito, Luc Marti Clauzel, Anna Abella Marti, Silvia Garcia Vicente, Xavier Testar Ymbert, Antonio Zorzano Olarte, Manuel Palacin Prieto, Fernando Albericio Palomera, Francesc Yraola Font, Alec Mian
  • Publication number: 20080070987
    Abstract: The invention provides compounds of Formula (I): and Formula (II) or a pharmaceutically-acceptable salt, solvate, or hydrate thereof. Compounds of this invention, or pharmaceutical compositions thereof, are useful for treating diabetes, elevated plasma glucose levels, and/or ketoacidosis in mammals.
    Type: Application
    Filed: May 14, 2007
    Publication date: March 20, 2008
    Inventors: Francesc Yraola Font, Silvia Garcia Vicente, Juan Fernandez Recio, Fernando Albericio Palomera, Antonio Zorzano Olarte, Miriam Royo Exposito, Luc Marti Clauzel
  • Publication number: 20060287529
    Abstract: Lamellarins are prepared using a solid phase synthesis. In a first aspect, the process includes a step as follows: Formula (I) where R1 to R15 are as defined, and X is halogen, provided that one of R2, R3 or R4 is immobilised to a resin. In a second aspect, the process includes a step as follows: Formula (II) where R1? to R5?, R11? and R13? are as defined, X1 and X2 are halogen, M is a metal function and PG is an amino protecting group, provided that one of that R2?, R3? or R4? is immobilised to a resin.
    Type: Application
    Filed: February 20, 2004
    Publication date: December 21, 2006
    Inventors: Mercedes Alvarez, Fernando Albericio, Pablo Cironi, Carmen Cue Vas, Andreas Francesch, Marta Marfil
  • Publication number: 20040214755
    Abstract: A process is provided for preparing kahalalide F and which leads to other kahalalide mimic compounds having useful biological activity.
    Type: Application
    Filed: June 3, 2003
    Publication date: October 28, 2004
    Inventors: Fernando Albericio, Ernest Giralt, Jose Carlos Jimenez, Angel Lopez, Ignacio Manzanares, Ignacio Rodrigues, Miriam Royo