Abstract: Systems and methods herein describe a mental health management system. The mental health management system accesses patient data associated with a patient from a database, determines that the patient is associated with a trigger event, identifies a category associated with the trigger event, generates a notification based on the trigger event and the identified category, validates the notification based on a notification history and transmits the notification to a computing device.

Abstract: The present invention provides a display screen with an integrated video camera optimized to capture the display screen's information. A presenter writes or draws information on the display screen while facing an audience. The video camera is located on the side opposite from the presenter. No extraneous video production equipment or technical expertise is required to operate while providing a compact and easily transportable system.

Abstract: A call processing method and call processing device are provided. The method provides a media server that receives an initial call request sent by a calling terminal and forwards the initial call request to a called terminal. The media server receives a success response to the initial call request from the called terminal, and performs video resource negotiation with the called terminal. The media server sends, based on video resource negotiation with the called terminal, a video stream to the called terminal. In an audio call process between a calling user and a called user, a video stream can be sent to the called user. This improves user experience and improves network capability utilization.

Abstract: Disclosed is an oral drug delivery device, comprising a tubular member, a drug holding part, a device cap and a turbulence-creating means. The tubular member has openings at both ends and an inner cavity; the opening at one end is a first opening and the opening at the other end is a second opening; the inner cavity communicates the first opening and the second opening. The turbulence-creating means comprises a step structure or a fold structure, and is disposed in the inner cavity and positioned between the second opening and the drug holding part. By using the oral drug delivery device of the present invention, turbulence can be generated during a normal sipping process, thereby providing ample mixing of drug-containing granules or multi-particulates with drinkable liquids. Moreover, the device is telescopic, which reduces the size and is convenient to carry.

Abstract: Embodiments of the present invention relate to an information sharing method and apparatus. The method includes: sharing, by a first terminal, specified content with a specified sharing user when a preset sharing condition is met, where the sharing condition is at least one of the following factors: a current time of the first terminal is a preset time; a current time of the first terminal falls within a preset time range; a current geographic location of the first terminal is a preset geographic location; or a current geographic location of the first terminal falls within a preset geographic location range. According to the present invention, a sharing condition such as a time or a geographic location is preset, and content is shared with a specified user according to the sharing condition, thereby simplifying complexity of sharing information in a future time period and improving usability of information sharing.

Abstract: Generating images and videos depicting a human subject wearing textually defined attire is described. An image generation system receives a two-dimensional reference image depicting a person and a textual description describing target clothing in which the person is to be depicted as wearing. To maintain a personal identity of the person, the image generation system implements a generative model, trained using both discriminator loss and perceptual quality loss, which is configured to generate images from text. In some implementations, the image generation system is configured to train the generative model to output visually realistic images depicting the human subject in the target clothing. The image generation system is further configured to apply the trained generative model to process individual frames of a reference video depicting a person and output frames depicting the person wearing textually described target clothing.

Abstract: The present disclosure discloses a method and an electronic device for displaying an application interface. The method includes: acquiring, by an electronic device when displaying an interface corresponding to a first application, a first input operation of a user; and simultaneously displaying, according to preset correlation information when the first input operation is a first preset operation, the interface corresponding to the first application and an interface corresponding to a second application, where the correlation information is used to indicate that the second application is an application that correlates with the first application. A corresponding electronic device is further provided. By adopting the present disclosure, interfaces respectively corresponding to multiple applications are simultaneously displayed on a display device, which may enhance user experience.

Abstract: A graphics processing method and apparatus, and relates to the field of chip technologies. The method includes: obtaining a first virtual address to be accessed by the GPU, where the first virtual address belongs to a first virtual address space; and obtaining a second virtual address based on the first virtual address, where the second virtual address belongs to a second virtual address space. The second virtual address space is different from the first virtual address space, the second virtual address space and the first virtual address space are mapped to a same physical address space, a physical address to which the first virtual address is mapped corresponds to image data in a first format, and a physical address to which the second virtual address is mapped corresponds to image data in a second format.

Abstract: Atomically dispersed platinum-group metal-free catalyst and method for synthesizing the same. According to one embodiment, the catalyst is made by a method in which, in a first step, an Mn-doped ZIF-8 catalyst precursor is prepared by reacting a first solution comprising zinc nitrate hexahydrate and manganese chloride dissolved in an acid/water solution with a second solution comprising 2-methylimidazole dissolved in water. Then, in a second step, the Mn-doped ZIF-8 catalyst precursor is thermally activated, i.e., carbonized, to form an Mn—N—C catalyst. Preferably, the thermal activation is performed in a multistep fashion, first at a lower temperature of about 800° C. and then at a higher temperature of about 1100° C. After carbonization, the catalyst material may optionally be subjected to an absorption process, followed by a second thermal activation. The absorption process may involve dispersing the catalyst material in a solution of manganese chloride and urea in hydrochloric acid and isopropanol.

Abstract: The present invention provides a reagent mixing device, which comprises a driving device, a transport device and a rotating part, wherein the transport device comprises a conveying mechanism for conveying a reagent kit and a mixing mechanism for mixing a reagent; the conveying mechanism is driven by the driving device to move relative to the mixing mechanism; the rotating part and mixing mechanism are in transmission matching; the conveying mechanism and the mixing mechanism are sleeved with each other to form a bearing structure. The present invention further provides a reagent mixing method. The reagent mixing device is small in size, smart in structure, easy to assemble and low in manufacturing cost. The reagent mixing method provided by the present invention is simple and reliable, high in overall operation reliability, and has very high application values in such analysis and test fields as full-automatic chemiluminescence immunoassay analyzers and biochemical analyzers.

Abstract: The present disclosure relates to systems, non-transitory computer-readable media, and methods to generate sketches for clearing-bid values and bid-success rates based on multi-dimensional targeting criteria for a digital-content campaign and dynamically determine predicted values for the digital-content campaign based on the sketches. To illustrate, the disclosed systems can use a running-average-tuple-sketch to generate tuple sketches of historical clearing-bid values and tuple sketches of historical bid-success-rates from historical auction data. Based on the tuple sketches, the disclosed systems can determine one or more of a predicted cost per quantity of impressions, a predicted number of impressions, or a predicted expenditure for the digital-content campaign—according to user-input targeting criteria and expenditure constraints.

Abstract: A hybrid beamforming method and device are disclosed. The method may include: sending a test request of an analog beam corresponding to physical antennas and a test request of a digital beam corresponding to radio frequency (RF) front ends, the physical antennas being divided into at least two groups, in which each group of physical antennas corresponds to one of the RF front ends; within a preset test period, switching states of connection between the groups of physical antennas and the RF front ends; and after the test period is over, managing the states of connection between the physical antennas and the RF front ends according to test results for the test requests, where the test results comprise a test result for the analog beam and a test result for the digital beam.

Abstract: A deep relational factorization machine (“DRFM”) system is configured to provide a high-order prediction based on high-order feature interaction data for a dataset of sample nodes. The DRFM system can be configured with improved factorization machine (“FM”) techniques for determining high-order feature interaction data describing interactions among three or more features. The DRFM system can be configured with improved graph convolutional neural network (“GCN”) techniques for determining sample interaction data describing sample interactions among sample nodes, including sample interaction data that is based on the high-order feature interaction data. The DRFM system generates a high-order prediction based on the high-order feature interaction embedding vector and the sample interaction embedding vector. The high-order prediction can be provided to a prediction computing system configured to perform operations based on the high-order prediction.

Abstract: This application relates to a photographing method and a terminal. The terminal includes a front-facing camera, a rear-facing camera, and a touch display screen detects that the front-facing camera is enabled; displays a preview image that is captured in selfie mode by using the front-facing camera; detects an enabling command of a user on a photographing shutter, enters a first user interface, and displays, on the first user interface, a first image and a second image that is a mirror of the first image; and in response to a selection of the user for the first image or the second image displayed on the first user interface, displays an image selected from the first image and the second image.

Abstract: Embodiments of the present invention relate to an information sharing method and apparatus. The method includes: sharing, by a first terminal, specified content with a specified sharing user when a preset sharing condition is met, where the sharing condition is at least one of the following factors: a current time of the first terminal is a preset time; a current time of the first terminal falls within a preset time range; a current geographic location of the first terminal is a preset geographic location; or a current geographic location of the first terminal falls within a preset geographic location range. According to the present invention, a sharing condition such as a time or a geographic location is preset, and content is shared with a specified user according to the sharing condition, thereby simplifying complexity of sharing information in a future time period and improving usability of information sharing.

Abstract: The present invention relates to a heat preservation shell (4) for an analyzer. At least one liquid passage (402) for conveying the liquid is embedded in a shell wall of the heat preservation shell. The liquid passage (402) is embedded in the shell wall of the heat preservation shell (4), on one hand, the liquid transported or preserved in the liquid passage is subjected to the heat preservation function of the heat preservation shell, so that the liquid transported or preserved in the liquid passage (402) maintains the preset temperature, thereby avoiding the influence of the external environment temperature on the transported liquid; and on the other hand, the space of the shell wall of the heat preservation shell is effectively utilized, the situation that various liquid pipelines are intricately distributed inside or outside the heat preservation shell (4) is avoided, thereby increasing the space utilization rate.

Abstract: Generating images and videos depicting a human subject wearing textually defined attire is described. An image generation system receives a two-dimensional reference image depicting a person and a textual description describing target clothing in which the person is to be depicted as wearing. To maintain a personal identity of the person, the image generation system implements a generative model, trained using both discriminator loss and perceptual quality loss, which is configured to generate images from text. In some implementations, the image generation system is configured to train the generative model to output visually realistic images depicting the human subject in the target clothing. The image generation system is further configured to apply the trained generative model to process individual frames of a reference video depicting a person and output frames depicting the person wearing textually described target clothing.

Abstract: Provided is an underwater repair system for a cavity region of a concrete panel rock-fill dam panel, including a moving platform, a work cabin, a pressure drainage apparatus, a traction apparatus, and a positioning apparatus; the traction apparatus controlling the movement of the moving platform on the surface of a dam concrete panel; the positioning apparatus transmits a detection position; the work cabin is a pressure cabin, the work cabin being connected to the pressure drainage apparatus, and a drill apparatus and grouting apparatus being arranged in the work cabin; the moving platform moves into the cavity region, and the pressure drainage apparatus starts up to drain the water in the work cabin, a partially closed waterless space being formed inside the work cabin, the drill apparatus drilling the concrete panel at the upper end of the cavity region and the grouting apparatus subsequently implementing grouting to complete the repair.

Abstract: The present invention provides compounds of Formula (I), or stereoisomers, tautomers, or pharmaceutically acceptable salts or solvates thereof, wherein all the variables are as defined herein. These compounds modulate the activity of farnesoid X receptor (FXR), for example, as agonists. This invention also relates to pharmaceutical compositions comprising these compounds and methods of treating a disease, disorder, or condition associated with FXR dysregulation, such as pathological fibrosis, transplant rejection, cancer, osteoporosis, and inflammatory disorders, by using the compounds and pharmaceutical compositions.

Abstract: The present invention relates to a cyclic peptide from a novel bone morphogenetic protein 2 (BMP2), a preparation method therefor and an application thereof. The cyclic peptide from the novel BMP2 is selected from one of the following cyclized polypeptides: 1. a cyclized polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC; and 2. a cyclized polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. The present invention also relates to a preparation method for the cyclic peptide from the novel BMP2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.