Patents by Inventor Konomu Hirao

Konomu Hirao has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 9278146
    Abstract: A new peptide derivative is provided.
    Type: Grant
    Filed: October 7, 2011
    Date of Patent: March 8, 2016
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Hiroyuki Kimura, Kentaro Toyoda, Konomu Hirao, Hirokazu Matsuda
  • Patent number: 9238083
    Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.
    Type: Grant
    Filed: September 29, 2010
    Date of Patent: January 19, 2016
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Publication number: 20150231284
    Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DESK*?QMEEEAVRLFIEVVLK*?NGGPSSGAPPPSK-NH2?(1) *-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(2) *-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(3) *-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(4), wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.
    Type: Application
    Filed: March 30, 2015
    Publication date: August 20, 2015
    Applicants: ARKRAY, INC., KYOTO UNIVERSITY
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Patent number: 9084831
    Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.
    Type: Grant
    Filed: March 17, 2011
    Date of Patent: July 21, 2015
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa
  • Publication number: 20150185159
    Abstract: An analysis system is configured by combining a mobile terminal equipped with a camera, and an auxiliary apparatus for analysis. The auxiliary apparatus includes a placing section on which the mobile terminal is placed. A chip mounting section and a light source are provided below the placing section. The placing section includes a light passing section for making transmitted light or reflected light in a coloring reaction portion, emitted from the light, incident on the camera. The camera is used as a light receiving section. A data processing section included in the mobile terminal is used as a concentration calculating processing section and, when the light in the coloring reaction portion passes through the light passing section and is made incident on the camera, is capable of executing the concentration calculation processing on the basis of data on a picked-up image signal output from the camera.
    Type: Application
    Filed: January 13, 2015
    Publication date: July 2, 2015
    Inventors: Takahiko Morita, Konomu Hirao
  • Patent number: 8980220
    Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.
    Type: Grant
    Filed: December 9, 2010
    Date of Patent: March 17, 2015
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Patent number: 8784624
    Abstract: The present invention relates to an enzyme electrode including: a carbon particle; a metal particle held on the carbon particle, the metal particle having a catalytic activity against a redox reaction; a redox enzyme. The enzyme electrode of the present invention further includes a high-resistance particle enhancing an electrical resistance, the high-resistance particle being chemically stable. The high-resistance particle contains an inorganic substance, for example. The inorganic substance is aluminum oxide or smectite, for example.
    Type: Grant
    Filed: July 11, 2007
    Date of Patent: July 22, 2014
    Assignee: Arkray, Inc.
    Inventors: Koji Katsuki, Konomu Hirao, Kenji Nagakawa, Masashi Okamoto, Yoshiaki Fujinawa
  • Patent number: 8642008
    Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.
    Type: Grant
    Filed: August 31, 2010
    Date of Patent: February 4, 2014
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Publication number: 20130052132
    Abstract: The present invention relates to a method for producing a polypeptide.
    Type: Application
    Filed: February 9, 2012
    Publication date: February 28, 2013
    Applicants: ARKRAY, Inc., Kyoto University
    Inventors: Hideo Saji, Nobuya Inagaki, Hiroyuki Kimura, Kentaro Toyoda, Konomu Hirao, Hirokazu Matsuda
  • Publication number: 20120107239
    Abstract: A precursor of a molecular probe for imaging of pancreatic islets is a compound expressed as the following formula (I): wherein -V-X represents a substituent on a benzene ring, V represents a bond, R1, of OR1, R1 represents a C1-C6 alkylene group, R2 represents H (hydrogen atom), a C1-C6 alkyl group, a C7-C10 aralkyl group, or a protecting group, X represents a OMs group, a OTs group, a OTf group, Br (bromine atom), or I (iodine atom), and carbon marked with * is an asymmetric carbon atom.
    Type: Application
    Filed: March 16, 2010
    Publication date: May 3, 2012
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa
  • Publication number: 20120087863
    Abstract: A new peptide derivative is provided.
    Type: Application
    Filed: October 7, 2011
    Publication date: April 12, 2012
    Applicants: ARKRAY, Inc., Kyoto University
    Inventors: Hideo Saji, Nobuya Inagaki, Hiroyuki Kimura, Kentaro Toyoda, Konomu Hirao, Hirokazu Matsuda
  • Publication number: 20110206605
    Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.
    Type: Application
    Filed: December 9, 2010
    Publication date: August 25, 2011
    Applicants: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Publication number: 20110171129
    Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.
    Type: Application
    Filed: March 17, 2011
    Publication date: July 14, 2011
    Applicants: Kyoto University, Arkray, Inc.
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa
  • Publication number: 20110081663
    Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.
    Type: Application
    Filed: September 29, 2010
    Publication date: April 7, 2011
    Applicants: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Publication number: 20110059483
    Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides; polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides; Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B—in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.
    Type: Application
    Filed: August 31, 2010
    Publication date: March 10, 2011
    Applicants: Kyoto University, ARKRAY, Inc.
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Publication number: 20110033381
    Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DLSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (1) ?*-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (2) ??*-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (3) ???*-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2, (4) wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.
    Type: Application
    Filed: August 10, 2010
    Publication date: February 10, 2011
    Applicants: Kyoto University, ARKRAY, Inc.
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Patent number: 7867756
    Abstract: A sample analysis device is provided in which a target component to be analyzed is prevented from being contaminated by a sample itself, which can be formed in an appropriate size, and which has excellent operability. In a sample analysis device 1 in which a sample is to be held in a porous sheet 13, supporting films 11 and 12 are stuck on front and rear faces of the porous sheet 13, respectively, and a sample supply hole 14 is formed in a part of the supporting films.
    Type: Grant
    Filed: April 11, 2002
    Date of Patent: January 11, 2011
    Assignee: ARKRAY, Inc.
    Inventors: Konomu Hirao, Yasuhito Murata
  • Publication number: 20100187107
    Abstract: The present invention relates to an enzyme electrode including: a carbon particle; a metal particle held on the carbon particle, the metal particle having a catalytic activity against a redox reaction; a redox enzyme. The enzyme electrode of the present invention further includes a high-resistance particle enhancing an electrical resistance, the high-resistance particle being chemically stable. The high-resistance particle contains an inorganic substance, for example. The inorganic substance is aluminum oxide or smectite, for example.
    Type: Application
    Filed: July 11, 2007
    Publication date: July 29, 2010
    Applicant: ARKRAY, INC.
    Inventors: Koji Katsuki, Konomu Hirao, Kenji Nagakawa, Masashi Okamoto, Yoshiaki Fujinawa
  • Patent number: 7239904
    Abstract: The invention relates to measuring the concentration of a target component in an object. The invention provides a component concentration measurement method including a first step in which light is irradiated onto a measurement object held in a first magnetic field state for detecting the light from the object, a second step in which light is irradiated onto the object held in a second magnetic field state different from the first state for detecting the light from the object, and a third step in which the concentration of the target component is calculated based on the detection results in the first and the second steps. The first magnetic field state may be a magnetic-field-modulated state, while the second state may be a non-magnetic-field-modulated state.
    Type: Grant
    Filed: May 7, 2003
    Date of Patent: July 3, 2007
    Assignee: Arkray, Inc.
    Inventor: Konomu Hirao
  • Publication number: 20050171415
    Abstract: The invention relates to measuring the concentration of a target component in an object. The invention provides a component concentration measurement method including a first step in which light is irradiated onto a measurement object held in a first magnetic field state for detecting the light from the object, a second step in which light is irradiated onto the object held in a second magnetic field state different from the first state for detecting the light from the object, and a third step in which the concentration of the target component is calculated based on the detection results in the first and the second steps. The first magnetic field state may be a magnetic-field-modulated state, while the second state may be a non-magnetic-field-modulated state.
    Type: Application
    Filed: May 7, 2003
    Publication date: August 4, 2005
    Applicant: ARKRAY, Inc.
    Inventor: Konomu Hirao