Patents by Inventor Konomu Hirao
Konomu Hirao has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 9278146Abstract: A new peptide derivative is provided.Type: GrantFiled: October 7, 2011Date of Patent: March 8, 2016Assignees: Kyoto University, ARKRAY, Inc.Inventors: Hideo Saji, Nobuya Inagaki, Hiroyuki Kimura, Kentaro Toyoda, Konomu Hirao, Hirokazu Matsuda
-
Patent number: 9238083Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.Type: GrantFiled: September 29, 2010Date of Patent: January 19, 2016Assignees: Kyoto University, ARKRAY, Inc.Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20150231284Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DESK*?QMEEEAVRLFIEVVLK*?NGGPSSGAPPPSK-NH2?(1) *-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(2) *-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(3) *-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(4), wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.Type: ApplicationFiled: March 30, 2015Publication date: August 20, 2015Applicants: ARKRAY, INC., KYOTO UNIVERSITYInventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Patent number: 9084831Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.Type: GrantFiled: March 17, 2011Date of Patent: July 21, 2015Assignees: Kyoto University, ARKRAY, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa
-
Publication number: 20150185159Abstract: An analysis system is configured by combining a mobile terminal equipped with a camera, and an auxiliary apparatus for analysis. The auxiliary apparatus includes a placing section on which the mobile terminal is placed. A chip mounting section and a light source are provided below the placing section. The placing section includes a light passing section for making transmitted light or reflected light in a coloring reaction portion, emitted from the light, incident on the camera. The camera is used as a light receiving section. A data processing section included in the mobile terminal is used as a concentration calculating processing section and, when the light in the coloring reaction portion passes through the light passing section and is made incident on the camera, is capable of executing the concentration calculation processing on the basis of data on a picked-up image signal output from the camera.Type: ApplicationFiled: January 13, 2015Publication date: July 2, 2015Inventors: Takahiko Morita, Konomu Hirao
-
Patent number: 8980220Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.Type: GrantFiled: December 9, 2010Date of Patent: March 17, 2015Assignees: Kyoto University, ARKRAY, Inc.Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Patent number: 8784624Abstract: The present invention relates to an enzyme electrode including: a carbon particle; a metal particle held on the carbon particle, the metal particle having a catalytic activity against a redox reaction; a redox enzyme. The enzyme electrode of the present invention further includes a high-resistance particle enhancing an electrical resistance, the high-resistance particle being chemically stable. The high-resistance particle contains an inorganic substance, for example. The inorganic substance is aluminum oxide or smectite, for example.Type: GrantFiled: July 11, 2007Date of Patent: July 22, 2014Assignee: Arkray, Inc.Inventors: Koji Katsuki, Konomu Hirao, Kenji Nagakawa, Masashi Okamoto, Yoshiaki Fujinawa
-
Patent number: 8642008Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.Type: GrantFiled: August 31, 2010Date of Patent: February 4, 2014Assignees: Kyoto University, ARKRAY, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20130052132Abstract: The present invention relates to a method for producing a polypeptide.Type: ApplicationFiled: February 9, 2012Publication date: February 28, 2013Applicants: ARKRAY, Inc., Kyoto UniversityInventors: Hideo Saji, Nobuya Inagaki, Hiroyuki Kimura, Kentaro Toyoda, Konomu Hirao, Hirokazu Matsuda
-
Publication number: 20120107239Abstract: A precursor of a molecular probe for imaging of pancreatic islets is a compound expressed as the following formula (I): wherein -V-X represents a substituent on a benzene ring, V represents a bond, R1, of OR1, R1 represents a C1-C6 alkylene group, R2 represents H (hydrogen atom), a C1-C6 alkyl group, a C7-C10 aralkyl group, or a protecting group, X represents a OMs group, a OTs group, a OTf group, Br (bromine atom), or I (iodine atom), and carbon marked with * is an asymmetric carbon atom.Type: ApplicationFiled: March 16, 2010Publication date: May 3, 2012Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa
-
Publication number: 20120087863Abstract: A new peptide derivative is provided.Type: ApplicationFiled: October 7, 2011Publication date: April 12, 2012Applicants: ARKRAY, Inc., Kyoto UniversityInventors: Hideo Saji, Nobuya Inagaki, Hiroyuki Kimura, Kentaro Toyoda, Konomu Hirao, Hirokazu Matsuda
-
Publication number: 20110206605Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.Type: ApplicationFiled: December 9, 2010Publication date: August 25, 2011Applicants: Kyoto University, ARKRAY, Inc.Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20110171129Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.Type: ApplicationFiled: March 17, 2011Publication date: July 14, 2011Applicants: Kyoto University, Arkray, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa
-
Publication number: 20110081663Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.Type: ApplicationFiled: September 29, 2010Publication date: April 7, 2011Applicants: Kyoto University, ARKRAY, Inc.Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20110059483Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides; polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides; Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B—in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.Type: ApplicationFiled: August 31, 2010Publication date: March 10, 2011Applicants: Kyoto University, ARKRAY, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20110033381Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DLSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (1) ?*-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (2) ??*-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (3) ???*-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2, (4) wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.Type: ApplicationFiled: August 10, 2010Publication date: February 10, 2011Applicants: Kyoto University, ARKRAY, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Patent number: 7867756Abstract: A sample analysis device is provided in which a target component to be analyzed is prevented from being contaminated by a sample itself, which can be formed in an appropriate size, and which has excellent operability. In a sample analysis device 1 in which a sample is to be held in a porous sheet 13, supporting films 11 and 12 are stuck on front and rear faces of the porous sheet 13, respectively, and a sample supply hole 14 is formed in a part of the supporting films.Type: GrantFiled: April 11, 2002Date of Patent: January 11, 2011Assignee: ARKRAY, Inc.Inventors: Konomu Hirao, Yasuhito Murata
-
Publication number: 20100187107Abstract: The present invention relates to an enzyme electrode including: a carbon particle; a metal particle held on the carbon particle, the metal particle having a catalytic activity against a redox reaction; a redox enzyme. The enzyme electrode of the present invention further includes a high-resistance particle enhancing an electrical resistance, the high-resistance particle being chemically stable. The high-resistance particle contains an inorganic substance, for example. The inorganic substance is aluminum oxide or smectite, for example.Type: ApplicationFiled: July 11, 2007Publication date: July 29, 2010Applicant: ARKRAY, INC.Inventors: Koji Katsuki, Konomu Hirao, Kenji Nagakawa, Masashi Okamoto, Yoshiaki Fujinawa
-
Patent number: 7239904Abstract: The invention relates to measuring the concentration of a target component in an object. The invention provides a component concentration measurement method including a first step in which light is irradiated onto a measurement object held in a first magnetic field state for detecting the light from the object, a second step in which light is irradiated onto the object held in a second magnetic field state different from the first state for detecting the light from the object, and a third step in which the concentration of the target component is calculated based on the detection results in the first and the second steps. The first magnetic field state may be a magnetic-field-modulated state, while the second state may be a non-magnetic-field-modulated state.Type: GrantFiled: May 7, 2003Date of Patent: July 3, 2007Assignee: Arkray, Inc.Inventor: Konomu Hirao
-
Publication number: 20050171415Abstract: The invention relates to measuring the concentration of a target component in an object. The invention provides a component concentration measurement method including a first step in which light is irradiated onto a measurement object held in a first magnetic field state for detecting the light from the object, a second step in which light is irradiated onto the object held in a second magnetic field state different from the first state for detecting the light from the object, and a third step in which the concentration of the target component is calculated based on the detection results in the first and the second steps. The first magnetic field state may be a magnetic-field-modulated state, while the second state may be a non-magnetic-field-modulated state.Type: ApplicationFiled: May 7, 2003Publication date: August 4, 2005Applicant: ARKRAY, Inc.Inventor: Konomu Hirao