Abstract: This invention relates to in vitro cell culture employing a fibrin network in a flexible gas permeable container. Specifically, the invention is directed to a cell culture container comprising a flexible, gas permeable material with fibrin matrix which is conducive to the culture of anchorage dependent cells, and the container is suitable for use in closed system in vitro cell culture. The gas permeability of the container is sufficient to permit cellular respiration.

Abstract: A pin pickup and article holder apparatus can be removably attachable to any metal surface of a sewing machine for retaining loose pins as well as loose sewing articles, such as chalk, spools of thread, buttons, beads, etc. The apparatus comprises a first body cushion and a second body cushion, where the first body cushion has a magnet that is embedded thereto so that the magnet can be removably attachable to any metal surface of the sewing machine. An elastic netting is attached to the first body cushion for retaining chalk, spools of thread, etc. thereto. A pen opening is provided on front of the first body cushion for retaining and securing a pen or writing instrument thereto. The second body cushion also has a magnet that is embedded thereto for being removably attachable to the magnet of the first body cushion.

Abstract: The present invention relates to cells which have improved receptivity to viruses which are capable of infecting them. Receptivity to such viruses is improved by selecting cells from a population which express the receptor(s) that enable a virus to attach to the cell and gain entry into it. Any combination of viruses and host cell lines can be used. In a preferred embodiment, the present invention relates to improving receptivity or infectivity of a cell line which can be infected with an immunodeficiency virus, such as HIV-1.

Abstract: The present invention relates to cells which have improved receptivity to viruses which are capable of infecting them. Receptivity to such viruses is improved by selecting cells from a population which express the receptor(s) that enable a virus to attach to the cell and gain entry into it. Any combination of viruses and host cell lines can be used.

Abstract: A spinal support and stretch pillow system offers a distinct, adjustable support for sleeping in either a supine position or a lateral-lying position. The spinal support and stretch pillow system can be laid over a conventional mattress or a floor. The spinal support and stretch pillow system is comprised of a bottom liner pad, a cervical and spinal support pad, a height adjustment pad, an adjustable shoulder support, an adjustable thoracic and lumbar support pad, and a top support pad. The bottom liner pad is used as a container to retain the components of the spinal support and stretch pillow system and for covering the user's legs and feet. The cervical and spinal support pad has a U-shaped cutout portion for allowing the head of the user to fall back and stretch the neck of the user. The height adjustment pad is positioned underneath a cervical section of the cervical and spinal pad for adjusting the height of the cervical section.

Abstract: A molecule which (i) binds human membrane-bound carcinoembryonic antigen, (ii) binds a hybrid polypeptide consisting of residues 1 to 314 of human biliary glycoprotein joined (N-C) to residues 490 to C-terminus of human carcino embryonic antigen, but (iii) does not bind to human biliary glycoprotein excluding an intact mouse monoclonal antibody comprising an IgG group IIA heavy chain and a kappa group V light chain wherein the sequence of the V.sub.H chain is QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWIN-TKTGEATYVEEFKGRFAFSLE TSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS, or wherein the sequence of the V.sub.H chain is as given immediately above but the first amino acid residue of the V.sub.H CDR1 is glutamine and in either case the sequence of the V.sub.L chain is GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG-SGTDFT LTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. Preferably the molecule is a monoclonal antibody.