Patents by Inventor Xianggan Li

Xianggan Li has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • NANO ANTIBODY AND USE THEREOF
    Publication number: 20230192865
    Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.
    Type: Application
    Filed: May 6, 2020
    Publication date: June 22, 2023
    Inventors: Zhe SONG, Youlin QI, Yaobin QIN, Jianfeng YANG, Limin HOU, Zhiwei ZHU, Qiuping DONG, Xianggan LI, Lei ZHANG, Jinyu WANG, Yuejin LI
  • Methods for generating transgenic plants
    Patent number: 11155827
    Abstract: This invention provides a method for generating transgenic plants with a low copy number. Plant cells are transformed with polynucleotides containing transcriptional cassettes designed to trigger silencing of a gene which is essential for the plant cell to survive the transformation and regeneration process. The present invention enables the recovery of an increased number of transgenic plants which have only one copy of each desired transcriptional cassette.
    Type: Grant
    Filed: September 3, 2019
    Date of Patent: October 26, 2021
    Assignee: Syngenta Participations AG
    Inventors: Xianggan Li, Sivamani Elumalai
  • METHODS FOR GENERATING TRANSGENIC PLANTS
    Publication number: 20190390206
    Abstract: This invention provides a method for generating transgenic plants with a low copy number. Plant cells are transformed with polynucleotides containing transcriptional cassettes designed to trigger silencing of a gene which is essential for the plant cell to survive the transformation and regeneration process. The present invention enables the recovery of an increased number of transgenic plants which have only one copy of each desired transcriptional cassette.
    Type: Application
    Filed: September 3, 2019
    Publication date: December 26, 2019
    Applicant: SYNGENTA PARTICIPATIONS AG
    Inventors: Xianggan Li, Sivamani Elumalai
  • Methods for generating transgenic plants
    Patent number: 10443063
    Abstract: This invention provides a method for generating transgenic plants with a low copy number. Plant cells are transformed with polynucleotides containing transcriptional cassettes designed to trigger silencing of a gene which is essential for the plant cell to survive the transformation and regeneration process. The present invention enables the recovery of an increased number of transgenic plants which have only one copy of each desired transcriptional cassette.
    Type: Grant
    Filed: June 6, 2014
    Date of Patent: October 15, 2019
    Assignee: Syngenta Participations AG
    Inventors: Xianggan Li, Sivamani Elumalai
  • METHODS FOR GENERATING TRANSGENIC PLANTS
    Publication number: 20140366223
    Abstract: This invention provides a method for generating transgenic plants with a low copy number. Plant cells are transformed with polynucleotides containing transcriptional cassettes designed to trigger silencing of a gene which is essential for the plant cell to survive the transformation and regeneration process. The present invention enables the recovery of an increased number of transgenic plants which have only one copy of each desired transcriptional cassette.
    Type: Application
    Filed: June 6, 2014
    Publication date: December 11, 2014
    Applicant: Syngenta Participations AG
    Inventors: Xianggan Li, Sivamani Elumalai
  • P gene promoter constructs for floral-tissue preferred gene expression
    Patent number: 5955361
    Abstract: This invention provides a transcriptional regulatory region of a gene which will be utilized to direct tissue-specific gene expression in plants such that a selective advantage is conferred upon said plants. The present invention relates to the isolation, characterization and utilization of a transcriptional regulatory region of a plant gene which is expressed in a floral tissue-specific manner. The transcriptional control region of said gene is demonstrated to drive gene expression in a floral-specific manner in vivo using transgenic plants.
    Type: Grant
    Filed: November 20, 1996
    Date of Patent: September 21, 1999
    Assignee: Pioneer Hi-Bred International, Inc.
    Inventors: Xianggan Li, Ben Bown, Thomas Peterson