Abstract: Anti-Her2 antibodies which induce apoptosis in Her2 expressing cells are disclosed. The antibodies are used to “tag” Her2 overexpressing tumors for elimination by the host immune system. Also disclosed are hybridoma cell lines producing the antibodies, methods for treating cancer using the antibodies, and pharmaceutical compositions.

Abstract: The present invention describes monoclonal antibodies which are useful for the specific detection of diffuse gastric carcinoma. Further embodiments describe therapeutic and diagnostic means for the detection and for the therapy of diffuse gastric carcinomas.

Abstract: A monoclonal antibody which recognizes an antigen of a molecular weight of 40 kD or 80 kD on the surface of tumor vessel endothelial cells, hybridomas producing said monoclonal antibody, pharmaceutical agents comprising said monoclonal antibody, as well as pharmaceutical or diagnostic agents comprising a conjugate of said monoclonal antibody and another conjugating molecule.

Abstract: The present invention is directed to a polynucleotide comprising open reading frames defining a coding region encoding a retinoblastoma binding protein (RBP-7) as well as regulatory regions located both at the 5′ end and the 3′ end of said coding region. The present invention also pertains to a polynucleotide carrying the natural regulation signals of the RBP-7 gene which is useful in order to express a heterologous nucleic acid in host cells or host organisms as well as functionally active regulatory polynucleotides derived from said regulatory region. The invention also concerns polypeptides encoded by the coding region of the RBP-7 gene. The invention also deals with antibodies directed specifically against such polypeptides that are useful as diagnostic reagents.

Abstract: Monoclonal antibodies that specifically bind to an extracellular domain of a flt-1 receptor and neutralize activation of the receptor are provided. In vitro and in vivo methods of using these antibodies are also provided.

Abstract: Humanized antibodies which bind the NR-LU-13 antigen, conjugates containing such antibodies, and their use in pretargeting methods and conventional antibody therapy and immunodiagnosis are provided.

Abstract: The present invention relates to a method by which one can target an undesired target molecule or target antigen, preferably a protein. The method comprises the intracellular expression of an antibody capable of binding to the target. A DNA sequence is delivered to a cell, the DNA sequence contains a sufficient number of nucleotides coding for the portion of an antibody capable of binding to the target operably linked to a promoter that will permit expression of the antibody in the cell(s) of interest. The antibody is then expressed intracellularly and binds to the target, thereby disrupting the target from its normal actions.

Abstract: According to the invention, there is provided a human or animal cell expressing an antibody directed against a surface antigen on an antigen-presenting cell (APC) and lacking parental tumor-derived immunoglobulin.

Abstract: This invention relates to monoclonal antibodies that recognize modified &bgr;-tubulin isotypes, methods of using such antibodies to detect modified &bgr;-tubulin isotypes, methods of using such antibodies to monitor &bgr;-tubulin modifying agents administered to a patient, methods of using such antibodies to isolate modified &bgr;-tubulin, and methods of detecting the anti-modified &bgr;-tubulin antibodies.

Abstract: An antibody reacting specifically with human LECT2. This antibody is produced by hybridoma clones G2A5D7 (Accession No. FERM P-15638), A1G1C6 (Accession No. FERM P-15639), 5C5 (Accession No. FERM P-15640), H12D10D6 (Accession No. FERM P-15641), etc. Human LECT2 can be assayed by reacting human LECT2 successively with an immobilized antibody which has been formed by binding the above-mentioned antibody to an insoluble support and a labeled antibody which has been formed by labeling another antibody reacting with human LECT2 with a labeling agent, and then determining the amount of label in the reaction product.

Abstract: A domain of Bcl-2 that suppresses apoptosis by allowing cell survival permits cell proliferation when mutated. The wild type domain includes amino acid residues 51 to 97 (SEQ ID NO:13) of Bcl-2. Peptides including the domain and nucleotides encoding the domain are useful in molecular screening of human tumors for the presence of mutations that allow proliferation of cells that were otherwise marked for apoptosis. The peptides are also useful to screen for proteins that play a role in the modulation of cellular proliferation.

Abstract: Breast cancer is detected by determining the presence of hK2 polypeptide or hK2 RNA in a physiological sample.

Abstract: A domain of Bcl-2 that suppresses apoptosis by allowing cell survival permits cell proliferation when mutated. The wild type domain includes amino acid residues 51 to 97 (SEQ ID NO:13) of Bcl-2. Peptides including the domain and nucleotides encoding the domain are useful in molecular screening of human tumors for the presence of mutations that allow proliferation of cells that were otherwise marked for apoptosis. The peptides are also useful to screen for proteins that play a role in the modulation of cellular proliferation.

Abstract: A reshaped human antibody or reshaped human antibody fragment having specificity for human polymorphic epithelial mucin (PEM) is produced by transferring the complementarity determining regions (CDRS) from a murine anti-HMFG hybridoma cell line HMFG1 into a human antibody variable region framework. The reshaped molecule can be used in the treatment or diagnosis of cancer.

Abstract: A gene, mcl-1, of the bcl-2 family is disclosed along with its nucleotide and amino acid sequence. Also disclosed are diagnostic and therapeutic methods of utilizing the mcl-1 nucleotide and polypeptide sequences.

Abstract: The present invention provides a trioma cell which does not produce any antibody obtained by fusing a hetermomyeloma cell which does not produce any antibody with a human lymphoid cell, wherein the heteromyeloma cell is designated B6B11. The invention also provides a tetroma cell capable of producing a monoclonal antibody having specific binding affinity for an antigen obtained by fusing a trioma cell which does not produce any antibody with a human lymphoid cell capable of producing antibody having specific binding affinity for the antigen. The invention also provides methods for generating trioma cells and tetroma cells, and the cells generated by the methods.

Abstract: A method of inhibiting growth of tumor cells which overexpress a growth factor receptor or growth factor by treatment of the cells with antibodies which inhibit the growth factor receptor function, is disclosed. A method of treating tumor cells with antibodies which inhibit growth factor receptor function, and with cytotoxic factor(s) such as tumor necrosis factor, is also disclosed. By inhibiting growth factor receptor functions tumor cells are rendered more susceptible to cytotoxic factors.

Abstract: This invention provides a method for preparing a hybridoma cell line which produces a monoclonal antibody which specifically recognizes and binds to a tumor associated antigen which comprises: (a) cotransfecting a CREF-Trans 6 cell line with DNA isolated from a neoplastic, human cell and a plasmid which encodes a selectable or identifiable trait; (b) selecting transfected cells which express the selectable or identifiable trait; (c) recovering the cells so selected in step (b); (d) injecting the cells so recovered in step (c) into a suitable marine host; (e) maintaining the resulting first murine host for a period of time effective to induce the cells injected in step (d) to form a tumor in the murine host; (f) isolating the tumor formed in step (e); (g) obtaining tumor cells from the isolated tumor in step (f); (h) coating the tumor cells obtained in step (9) with an antiserum generated against the CREF Trans-6 cell line (i) injecting the antiserum-coated cells from step (h) into a plurality of suitable seco

Abstract: The invention provides a polynucleotide in substantially isolated form which includes a contiguous sequence of nucleotides which is capable of selectively hybridizing to SEQ ID NO: 1 or the complement of SEQ ID NO: 1, and a polypeptide in substantially isolated form which includes: (a) the protein in SEQ ID NO: 2; or (b) an allelic variant or species homologue thereof; or (c) a protein at least 70% homologous to (a); or (d) a fragment of any one of (a) to (c) capable of forming a complex with the E2 F-1 protein or related family member; or (e) a fragment of any one of (a) to (c) of at least 15 amino acids.

Abstract: The present invention relates to monoclonal antibodies that bind to the extracellular domain of prostate-specific membrane antigen (PSMA), hybridoma cell lines producing the antibodies, and methods of using such antibodies for diagnosis and treatment of cancer. In particular, thirty-five monoclonal antibodies reactive with PSMA expressed on the cell surface are exemplified. Additionally, the present invention relates to a novel protein variant (PSM') of PSMA detected by a number of the antibodies of the invention. The hydrolase activity of PSMA and PSM' allows the use of an immunoenzymatic assay for their detection.

Abstract: This invention relates generally to the field of immunology, in particular that of antibodies and antibody productions. More specifically, this invention relates to bispecific antibodies, the hybrid hybridomas which produce them, the parent hybridomas, the production and selection of the hybridomas and hybrid hybridomas, and the purification of the bispecific antibodies. Specific examples relate to bispecific monoclonal antibodies which recognize both the human multi-drug resistance antigen, P-glycoprotein and human Fc.gamma. receptor III (hFc.gamma.RIII. These bispecific antibodies are useful in killing cancer cells.

Abstract: A human monoclonal antibody specifically binding to a surface antigen of cancer cell membrane, an isolated DNA encoding the antibody, and a hybridoma producing the antibody. An anti-cancer formulation comprising the monoclonal antibody bonded to the surface of a liposome enclosing an anti-cancer agent or toxin is also provided.

Abstract: Hybridomas secreting monoclonal antibodies specific for an epitope found in the amino acids of LCGA associated with non-small cell lung carcinoma protein have been found. The monoclonal antibodies produced by these hybridomas can be used in in vivo and in vitro clinical diagnosis of non-small cell lung carcinoma and ovarian carcinoma and as target selective carriers for various anti-tumor agents and radioimaging agents.

Abstract: This invention relates generally to the field of immunology, in particular that of antibodies and antibody productions. More specifically, this invention relates to bispecific antibodies, the hybrid hybridomas which produce them, the parent hybridomas, the production and selection of the hybridomas and hybrid hybridomas, and the purification of the bispecific antibodies. Specific examples relate to bispecific monoclonal antibodies which recognize both the human multi-drug resistance antigen, P-glycoprotein and human Fc.gamma. receptor III (hFc.gamma.RIII). These bispecific antibodies are useful in killing cancer cells.

Abstract: CLNH5-specific hybridomas, human monoclonal antibodies and their uses are provided. The antibodies distinguish a human neoplastic cell from a normal cell of the same tissue type. The monoclonal antibodies find use in therapy and diagnosis, both in vitro and in vivo.

Abstract: This invention relates to the discovery of a differentiation antigen termed mesothelin which is associated with mesotheliomas and ovarian cancers. Mesothelin is about 69 kD in its full-length form. The invention includes uses for the amino acid and nucleic acid sequences for mesothelin, recombinant cells expressing it, methods for targeting and/or inhibiting the growth of cells bearing mesothelin, methods for detecting the antigen and its expression level as an indication of the presence of tumor cells, and kits for such detection.

Abstract: The invention relates to reshaped human monoclonal antibodies directed against isotypic determinants of immunoglobulin E (IgE), direct equivalents and derivatives of said antibodies. The molecules of the invention are useful for diagnostics, prophylaxis and treatment of allergy.

Abstract: A novel protein associated with multidrug resistance in living cells and capable of conferring multidrug resistance on a cell is disclosed. Nucleic acids encoding the novel multidrug resistance protein are also disclosed. Transformant cell lines which express the nucleic acid encoding the novel protein are also disclosed. Antibodies which bind the novel multidrug resistance protein are also disclosed. Diagnostic and treatment methods using the novel proteins, nucleic acids, antibodies and cell lines of the invention are also encompassed by the invention.

Abstract: CLNH11-specific hybridomas, human monoclonal antibodies and their uses are provided. The antibodies distinguish a human neoplastic cell from a normal cell of the same tissue type. The monoclonal antibodies find use in therapy and diagnosis, both in vitro and in vivo.

Abstract: CLNH5 and CLNH11 specific hybridomas, human monoclonal antibodies and their uses are provided. The antibodies distinguish a human neoplastic cell from a normal cell of the same tissue type. The monoclonal antibodies find use in therapy and diagnosis, both in vitro and in vivo.

Abstract: A new gene--MN--and proteins/polypeptides encoded therefrom are disclosed. Recombinant nucleic acid molecules for expressing MN proteins/polypeptides and fusion proteins are provided. Expression of the MN gene is disclosed as being associated with tumorigenicity, and the invention concerns methods and compositions for detecting and/or quantitating MN antigen and/or MN-specific antibodies in vertebrate samples that are diagnostic/prognostic for neoplastic and pre-neoplastic disease. Test kits embodying the immunoassays of this invention are provided. MN-specific antibodies are disclosed that can be used diagnostically/prognostically, therapeutically, for imaging, and/or for affinity purification of MN proteins/polypeptides. Also provided are nucleic acid probes for the MN gene as well as test kits comprising said probes. The invention also concerns vaccines comprising MN proteins/polypeptides which are effective to immunize a vertebrate against neoplastic diseases associated with the expression of MN proteins.

Abstract: The invention relates to monoclonal antibodies against a tumor-associated antigen which is mainly derived from tumors from the group of carcinomas of the breast, ovaries and prostate, as well as adenocarcinomas of the lung, which additionally react with polymorphic epithelial mucin (PEM), to the preparation and use thereof and to the use of the epitope defined by the antibody for diagnosis and therapy.

Abstract: A hybridoma (termed "UIC2 hybridoma", ATCC Accession No. HB11027) producing monoclonal antibodies (termed "UIC2 mAb") directed against an extracellular domain of a cell surface P-glycoprotein antigen associated with multidrug resistance in primate cells was produced by fusing a human myeloma cell with a spleen cell derived from a BALB/c mouse immunized with syngeneic 3T3 fibroblasts previously transfected with the isolated human mdr1 cDNA. UIC2 mAb, thus produced, as well as fragments and recombinant derivatives thereof, may be used to detect and isolate multidrug resistant primate cells and human mdr1 gene products, and to reverse multidrug resistance in primate cells, including cells of multidrug resistant human tumors.

Abstract: The invention concerns novel inhibitors of tumor necrosis factor receptor associated factor-(TRAF) mediated signal transduction. The invention encompasses the novel inhibitor proteins (I-TRAFs), nucleic acid encoding them, methods for their recombinant production, and their use in screening assays and as pharmaceuticals.

Abstract: Improved methods for the diagnosis and treatment of cancer which involve the targeting of slow-growing, relatively mutationally-spared cancer stemline are provided. These methods are an improvement over previous cancer detection and therapeutic methods because they provide for very early cancer detection and treatment and reduce the likelihood of clinical relapse after treatment.

Abstract: The invention relates to a novel monoclonal antibody, a hybridoma cell line producing said antibody, DNA sequences coding for said antibody, and amino acid sequences. The monoclonal antibody, a preferred embodiment of which is named 17E6, has the following properties:reacting only with the .alpha.V-chain of human .alpha.V-integrins,blocking the attachment to the integrin substrate of the .alpha.V-integrin bearing cell,triggering reversal of established cell matrix interaction caused by .alpha.V-integrins,blocking tumor development, andshowing no cytotoxic activity.

Abstract: The present invention provides a human tumor-associated Kazal inhibitor (HuKI) and polynucleotides which identify and encode HuKI. The invention also provides expression vectors, host cells, antibodies and antagonists. The invention also provides methods for the prevention and treatment of diseases associated with expression of HuKI, as well as diagnostic assays.

Abstract: Novel methods of detecting and treating breast cancer are described.

Abstract: A new gene--MN--and proteins/polypeptides encoded therefrom are disclosed. Recombinant nucleic acid molecules for expressing MN proteins/polypeptides and recombinant proteins are provided. Expression of the MN gene is disclosed as being associated with tumorigenicity, and the invention concerns methods and compositions for detecting and/or quantitating MN antigen and/or MN-specific antibodies in vertebrate samples that are diagnostic/prognostic for neoplastic and pre-neoplastic disease. Test kits embodying the immunoassays of this invention are provided. MN-specific antibodies are disclosed that can be used diagnostically/prognostically, therapeutically, for imaging, and/or for affinity purification of MN proteins/polypeptides. Also provided are nucleic acid probes for the MN gene as well as test kits comprising said probes.

Abstract: The present invention provides a monoclonal anti-idiotype antibody 3H1 that escapes immune tolerance and elicits a specific immune response to CEA in mice, rabbits, monkeys, and patients with advanced CEA-associated disease. This invention also provides compositions which can be used in the detection or treatment of CEA-associated tumors mimics a specific epitope on carcinoembryonic antigen and a hybridoma that produces 3H1.

Abstract: A qualitative, quantitative, as well as local determination of pyruvatkinase (ATP:pyruvate-2-O-phosphotransferase, EC 2.7.1.40)-isoenzyme typ M2 (Tumor-M2-PK) is possible in blood, plasma, tissue culture, tissue sections as well as in the animal and human organism with the help of antibodies.Corresponding antisera are obtained if highly purified pyruvatekinase-isoenzymes type M2 (Tumor-M2-PK) or fragments of these, are used as immunogen. Preferable are antisera with monoclonal antibodies.These antibodies can be used in ELISA-Test systems for the diagnosis of cancer, to determine the malignancy of cells, to localize a tumor in an organism as well as for the therapy of cancer.

Abstract: Antibodies are disclosed which bind to ErbB3 protein and further possess any one or more of the following properties: an ability to reduce heregulin-induced formation of an ErbB2-ErbB3 protein complex in a cell which expresses ErbB2 and ErbB3; the ability to increase the binding affinity of heregulin for ErbB3 protein; and the characteristic of reducing heregulin-induced ErbB2 activation in a cell which expresses ErbB2 and ErbB3.

Abstract: The present invention relates to a method by which one can target an undesired target molecule or target antigen, preferably a protein. The method comprises the intracellular expression of an antibody capable of binding to the target. A DNA sequence is delivered to a cell, the DNA sequence contains a sufficient number of nucleotides coding for the portion of an antibody capable of binding to the target operably linked to a promoter that will permit expression of the antibody in the cell(s) of interest. The antibody is then expressed intracellularly and binds to the target, thereby disrupting the target from its normal actions.

Abstract: A molecule which (i) binds human membrane-bound carcinoembryonic antigen, (ii) binds a hybrid polypeptide consisting of residues 1 to 314 of human biliary glycoprotein joined (N-C) to residues 490 to C-terminus of human carcino embryonic antigen, but (iii) does not bind to human biliary glycoprotein excluding an intact mouse monoclonal antibody comprising an IgG group IIA heavy chain and a kappa group V light chain wherein the sequence of the V.sub.H chain is QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWIN-TKTGEATYVEEFKGRFAFSLE TSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS, or wherein the sequence of the V.sub.H chain is as given immediately above but the first amino acid residue of the V.sub.H CDR1 is glutamine and in either case the sequence of the V.sub.L chain is GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG-SGTDFT LTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. Preferably the molecule is a monoclonal antibody.

Abstract: This invention relates generally to the field of immunology, in particular that of antibodies and antibody productions. More specifically, this invention relates to bispecific antibodies, the hybrid hybridomas which produce them, the parent hybridomas, the production and selection of the hybridomas and hybrid hybridomas, and the purification of the bispecific antibodies. Specific examples relate to bispecific monoclonal antibodies which recognize both the human multi-drug resistance antigen, P-glycoprotein and human Fc.gamma. receptor III (hFc.gamma.RIII). These bispecific antibodies are useful in killing cancer cells.

Abstract: Novel compositions are provided that are derived from antigen-binding sites of immunoglobulins having affinity for cancer antigens. The compositions exhibit immunological binding properties of antibody molecules capable of binding specifically to a human tumor cell displaying a MDR phenotype. A number of synthetic molecules are provided that include CDR and FR regions derived from same or different immunoglobulin moieties. Also provided are single chain polypeptides wherein V.sub.H and V.sub.L domains are attached by a single polypeptide linker. The sFv molecules can include ancillary polypeptide moieties which can be bioactive, or which provide a site of attachment for other useful moieties. The compositions are useful in specific binding assays, affinity purification schemes, drug or toxin targeting, imaging, and genetic or immunological therapeutics for various cancers.

Abstract: The present invention relates to monoclonal antibody 1A7. This is an anti-idiotype produced by immunizing with an antibody specific for ganglioside GD2, and identifying a hybridoma secreting antibody with immunogenic potential in a multi-step screening process. Also disclosed are polynucleotide and polypeptide derivatives based on 1A7, including single chain variable region molecules and fusion proteins, and various pharmaceutical compositions. When administered to an individual, the 1A7 antibody overcomes immune tolerance and induces an immune response against GD2, which comprises a combination of anti-GD2 antibody and GD2-specific T cells. The invention further provides methods for treating a disease associated with altered GD2 expression, particularly melanoma, neuroblastoma, glioma, soft tissue sarcoma, and small cell carcinoma. Patients who are in remission as a result of traditional modes of cancer therapy may be treated with a composition of this invention in hopes of reducing the risk of recurrence.

Abstract: Method for inactivating the function produced by a protein using an intracellularly expressed antibody or fragment thereof.

Abstract: The invention concerns an antibody active against an epitope coded by the exon v6 variant of the CD44 gene. The antibody concerned has characteristics superior to those of prior art antibodies and is suitable for use in therapy and diagnosis.

Abstract: There are produced recombinant gene pairs which endow mononuclear cells, mainly various lymphocyte type cells, with antibody-type specificity. In specific gene pairs the rearranged gene pairs code for a binding site of an antibody molecule from the same species, of the T-cell receptor gene, or another species. Gene pairs of the invention code, for example, for antibodies specific towards tumor-specific antigens, viral antigens, modified self antigens, bacterial or fungal antigens, autoimmune type disease antigens and the like. The invention further relates to expression vectors for the effective transfection of such cell types comprising such a recombinant gene pair, to methods for producing same and to pharmaceutical compositions comprising as active ingredient an effective quantity of lymphocytes transfected with such gene pairs.