Peptides Of 3 To 100 Amino Acid Residues Patents (Class 530/300)
  • Publication number: 20150057221
    Abstract: The present invention relates to a prodrug or a pharmaceutically acceptable salt thereof comprising a drug linker conjugate D-L, wherein -D is an amine containing biologically active moiety; and -L is a non-biologically active linker moiety -L1 represented by formula (I): wherein the dashed line indicates the attachment to the amine of the biologically active moiety and wherein R1, R1a, R2, R2a, R3, R3a, X, X1, X2, X3 have the meaning as indicated in the description and the claims and wherein L1 is substituted with one to four groups L2-Z and optionally further substituted, provided that the hydrogen marked with the asterisk in formula (I) is not replaced by a substituent; wherein L2 is a single chemical bond or a spacer; and Z is a carrier group. The invention also relates to A-L, wherein A is a leaving group, pharmaceutical composition comprising said prodrugs and their use as medicaments.
    Type: Application
    Filed: October 30, 2014
    Publication date: February 26, 2015
    Inventors: Felix Cleemann, Ulrich Hersel, Silvia Kaden, Harald Rau, Thomas Wegge
  • Patent number: 8962811
    Abstract: Methods of increasing the yield in plant expression of recombinant proteins comprising engineering glycosylation sites into cloned genes or cDNAs for proteins using codons that drive post-translational modifications in plants; and engineering the cloned genes or cDNAs to contain a plant secretory signal sequence that targets the gene products (protein) for secretion. The methods result in increased recombinant glycosylated protein yields. Proteins produced according to these methods are disclosed.
    Type: Grant
    Filed: April 3, 2013
    Date of Patent: February 24, 2015
    Assignee: Ohio University
    Inventors: Marcia J. Kieliszewski, Jianfeng Xu, John Kopchick, Shigeru Okada, Gary Meyer
  • Patent number: 8961981
    Abstract: Compositions and methods for targeting therapeutic agents to neuromuscular junctions are disclosed. Also disclosed are methods for treating diseases and conditions affecting the neuromuscular junction. Compositions include a neuromuscular junction targeting peptide coupled to a therapeutic agent. Compositions may further include a linker peptide. Methods for targeting therapeutic agents to neuromuscular junctions and treating diseases and conditions affecting the neuromuscular junction include administering a composition including a neuromuscular junction targeting peptide coupled to a therapeutic agent.
    Type: Grant
    Filed: June 19, 2012
    Date of Patent: February 24, 2015
    Assignee: Saint Louis University
    Inventors: Henry Kaminski, Linda Kusner, Namita Satija
  • Patent number: 8962569
    Abstract: Provided herein is tumor suppression composition and methods of making and using the same.
    Type: Grant
    Filed: May 25, 2011
    Date of Patent: February 24, 2015
    Assignees: The Regeants of the University of California, The United States of America as Represented by the Department of Veterans Affairs
    Inventors: Samuel S. Murray, Elsa J. Murray, Jeffrey C. Wang
  • Patent number: 8962548
    Abstract: Compositions and methods are provided that are useful for the delivery, including transdermal delivery, of biologically active agents, including nucleic acids and therapeutic proteins including insulin, larger therapeutic proteins such as botulinum toxin and other biologically active agents such as a therapeutic protein which does not therapeutically alter blood glucose levels, a therapeutic nucleic acid-based agent, a non-protein non-nucleic acid therapeutic agent such as an antifungal agent or alternately an agent for immunization. The compositions can be prepared with components useful for targeting the delivery of the compositions as well as imaging components.
    Type: Grant
    Filed: March 3, 2005
    Date of Patent: February 24, 2015
    Assignee: Revance Therapeutics, Inc.
    Inventors: Jacob M. Waugh, Michael D. Dake
  • Patent number: 8962793
    Abstract: Peptides, mimetics and antibodies of erbB, TNF, and IgSF receptors and pharmaceutical compositions comprising the same are described. Methods of using such antibodies, peptides, and mimetics in therapeutic, prophylactic, imaging and diagnostic applications are disclosed.
    Type: Grant
    Filed: April 25, 2013
    Date of Patent: February 24, 2015
    Assignee: The Trustees Of The University Of Pennsylvania
    Inventors: Mark I. Greene, Ramachandran Murali, Hongtao Zhang, Mark Richter, Alan Berezov, Qingdu Liu, Jinqiu Chen
  • Patent number: 8961986
    Abstract: There is provided a method for selecting a tolerogenic peptide by selecting a peptide which is capable of binding to an MHC class I or II molecule without further processing. There is also provided a peptide selected by such a method and its use in a pharmaceutical composition and a method to treat and/or prevent a disease. The present invention also relates to a composition which comprises the following myelin basic protein peptides: MBP 30-44; MBP 83-99; MBP 131-145; and MBP 140-154. The composition may be used to treat a disease, in particular multiple sclerosis and/or optical neuritis and the invention also relates to such uses and methods.
    Type: Grant
    Filed: December 6, 2012
    Date of Patent: February 24, 2015
    Assignee: Apitope Technology (Bristol) Limited
    Inventors: David Wraith, Heather Barbara Streeter
  • Patent number: 8961985
    Abstract: The present invention relates to peptides, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated cytotoxic T cell (CTL) peptide epitopes, alone or in combination with other tumor-associated peptides that serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses. The present invention relates to 30 peptide sequences and their variants derived from HLA class I and class II molecules of human tumor cells that can be used in vaccine compositions for eliciting anti-tumor immune responses.
    Type: Grant
    Filed: January 9, 2012
    Date of Patent: February 24, 2015
    Assignee: Immatics Biotechnologies GmbH
    Inventors: Toni Weinschenk, Oliver Schoor, Claudia Trautwein, Norbert Hilf, Steffan Walter, Harpreet Singh
  • Patent number: 8962804
    Abstract: Antibodies and meditopes that bind to the antibodies are provided, as well as complexes, compositions and combinations containing the meditopes and antibodies, and methods of producing, using, testing, and screening the same, including therapeutic and diagnostic methods and uses.
    Type: Grant
    Filed: April 10, 2012
    Date of Patent: February 24, 2015
    Assignee: City of Hope
    Inventors: John C. Williams, David A. Horne, Yuelong Ma, Heng Wei Chang, Joshua Michael Donaldson, Cindy Zer, Krzysztof Bzymek, Kendra Nicole Avery, Jun Xie
  • Patent number: 8962545
    Abstract: Administering an effective dose of glutenase to a Celiac or dermatitis herpetiformis patient reduces levels of toxic gluten oligopeptides, thereby attenuating or eliminating the damaging effects of gluten.
    Type: Grant
    Filed: March 21, 2011
    Date of Patent: February 24, 2015
    Assignee: The Board of Trustees of the Leland Stanford Junior University
    Inventors: Felix Hausch, Gary Gray, Lu Shan, Chaitan Khosla
  • Publication number: 20150050737
    Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.
    Type: Application
    Filed: October 30, 2014
    Publication date: February 19, 2015
    Applicant: FUJIFILM CORPORATION
    Inventors: Yuta MURAKAMI, Rie IWATA, Yoshihide IWAKI, Tasuku SASAKI
  • Patent number: 8957024
    Abstract: The present invention encompasses methods and combinations for substantially inhibiting the opioid-induced internalization of gastrin-releasing peptide receptor (GRPR) in a pruritus specific neuron. Such methods and combinations provide a direct means of treating opioid-induce pruritus without compromising opioid analgesia.
    Type: Grant
    Filed: July 27, 2012
    Date of Patent: February 17, 2015
    Assignee: Washington University
    Inventors: Zhou-Feng Chen, Xianyu Liu
  • Patent number: 8957186
    Abstract: The present invention relates to a recombinant protein for siRNA delivery, which allows the efficient intracellular and in vivo delivery of siRNA. More particularly, the present invention relates to a recombinant protein that allows a siRNA binding protein to be located in the interior cavity of a capsid protein of HBV (Hepatitis B virus), in which siRNAs of interest bind to the siRNA binding protein to be encapsulated within the capsid shell, thereby providing stability against the external attack such as nucleases and achieving the efficient intracellular and in vivo delivery of siRNA by its release into the cytosolic space after cell uptake.
    Type: Grant
    Filed: December 7, 2011
    Date of Patent: February 17, 2015
    Assignee: Korea Institute of Science and Technology
    Inventors: Hyung-Jun Ahn, Ick-Chan Kwon, Kui-Won Choi
  • Patent number: 8957050
    Abstract: The present invention is directed to a stabilized cross-linked hydrogel matrix comprising a first high molecular weight component and a second high molecular weight component that are covalently linked, and at least one stabilizing or enhancing agent, wherein the first high molecular weight component and the second high molecular weight component are each selected from the group consisting of polyglycans and polypeptides. This stabilized hydrogel matrix may be prepared as bioactive gels, pastes, slurries, cell attachment scaffolds for implantable medical devices, and casting or binding materials suitable for the construction of medical devices. The intrinsic bioactivity of the hydrogel matrix makes it useful as a gel or paste in multiple applications, including as a cell attachment scaffold that promotes wound healing around an implanted device, as gels and pastes for induction of localized vasculogenesis, wound healing, tissue repair, and regeneration, as a wound adhesive, and for tissue bulking.
    Type: Grant
    Filed: March 11, 2013
    Date of Patent: February 17, 2015
    Assignee: Pioneer Surgical Technology, Inc.
    Inventors: Francis Vincent Lamberti, Richard Chris Klann, Ronald Stewart Hill
  • Patent number: 8956622
    Abstract: The present invention concern a peptidic antagonist of class III semaphorins/neuropilins complexes comprising an amino acid sequence, which is derived from the transmembrane domain of a protein selected in the group consisting of neuropilin-1, neuropilin-2, plexin-A1, plexin-A2, plexin-A3, plexin-A4, Nr-CAM, L1-CAM, integrin Beta 1 and integrin beta 2, and including at least a GxxxG motif, eventually fused to an heterologous sequence; a nucleic acid encoding for said peptidic antagonist, a pharmaceutical composition comprising such a peptidic antagonist or a nucleic acid encoding thereof and uses thereof.
    Type: Grant
    Filed: June 28, 2006
    Date of Patent: February 17, 2015
    Assignee: INSERM—Institut National de la Sante et de la Recherche Medicale
    Inventors: Dominique Bagnard, Lise Roth, Cécile Nasarre, Pierre Hubert, Sylvie Dirrig-Grosch, Gerard Cremel, Dominique Aunis
  • Patent number: 8957026
    Abstract: The invention relates to ?-catenin targeting peptides comprising an ?-helical segment that are optionally stapled or stitched, and pharmaceutical compositions thereof. Uses of the inventive ?-catenin targeting polypeptides including methods for treatment of disease, such as diseases associated with aberrant Wnt signaling, including cancer, are also provided.
    Type: Grant
    Filed: September 22, 2011
    Date of Patent: February 17, 2015
    Assignee: President and Fellows of Harvard College
    Inventors: Gregory L. Verdine, Tom N. Grossmann, Tsung-Han Johannes Yeh
  • Publication number: 20150045293
    Abstract: Described herein are melanocortin analogs having enhanced activity and transport.
    Type: Application
    Filed: March 12, 2013
    Publication date: February 12, 2015
    Inventor: Kenneth Allen Gruber
  • Publication number: 20150045284
    Abstract: The present invention relates to crystals of a type IB P-type ATPase having the space group P1 and methods for purification and growing said crystals. The invention also presents methods for identifying an inhibitor of a type IB P-type ATPase for example by determining binding interactions between an inhibitor and a set of binding interaction sites in said type IB P-type ATPase.
    Type: Application
    Filed: January 20, 2012
    Publication date: February 12, 2015
    Applicant: Aarhus Universitet
    Inventors: Poul Nissen, Pontus Gourdon, Xiang Liu, Bjorn Panyella Pedersen, Daniel Mattle
  • Publication number: 20150045664
    Abstract: The present Invention relates to the monitoring of biological substances, such as non-invasive monitoring of such substances in animal, for examples biomarkers and metabolites. Specifically, the invention further relates to such monitoring using rare earth tagged marker compounds. The invention further relates to such monitoring using laser spectroscopy or Raman spectroscopy. The invention further relates to the use of such monitoring in disease states, such as stroke, neurological disorders and cardiovascular disorders.
    Type: Application
    Filed: March 7, 2013
    Publication date: February 12, 2015
    Inventors: Sikha Saha, Gin Jose, Animesh Jha
  • Patent number: 8952127
    Abstract: The present invention provides for a bio-mimetic polymer capable of catalyzing CO2 into a carbonate.
    Type: Grant
    Filed: June 3, 2011
    Date of Patent: February 10, 2015
    Assignee: The Regents of the University of California
    Inventors: Chun-Long Chen, Ronald N. Zuckermann, James J. De Yoreo
  • Patent number: 8952133
    Abstract: Methods and compositions for delivering polynucleotides are provided. One embodiment provides a non-viral vector comprising a recombinant polynucleotide-binding protein comprising a protein transduction domain operably linked to a targeting signal.
    Type: Grant
    Filed: February 17, 2012
    Date of Patent: February 10, 2015
    Assignee: Gencia Corporation
    Inventor: Shaharyar Khan
  • Publication number: 20150037492
    Abstract: The present invention discloses a method for producing wheat glutamine peptide using wheat gluten powder as raw material, belonging to the fields of food and biotechnology. The method includes the steps of: performing enzymolysis in two steps using Alcalase and papain with the wheat gluten powder as raw material, to obtain the wheat glutamine peptide with components with molecular weight of less than 1000 Da being more than 90%, characteristic glutamine peptide segment glutamine-arginine-glutamine (Gln-Arg-Gln, QRQ) content being more than 2.0% and glutamine content being up to 23.54% by treating the enzymatic hydrolysate by centrifugation, ultrafiltration, concentration, spray drying, etc. The produced glutamine peptide can be used as functional nutrition composition ingredient in the development and production of ordinary foods, health foods and medicines.
    Type: Application
    Filed: October 15, 2014
    Publication date: February 5, 2015
    Inventors: MUYI CAI, RUIZENG GU, JUN LU, FENG LIN, YONG MA, ZHE DONG, XINGCHANG PAN, YONGQING MA, YAGUANG XU, ZHENTAO JIN, LIANG CHEN, WENYING LlU, YING WEI, HAIXIN ZHANG, LU LU, YAN LIU, TAO MA, SIMENG JIANG, KELU CAO, JING WANG
  • Patent number: 8946156
    Abstract: The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acid vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.
    Type: Grant
    Filed: May 4, 2012
    Date of Patent: February 3, 2015
    Assignees: Human Genome Sciences, Inc., Novozymes Biopharma DK A/S
    Inventors: David J. Ballance, Darrell Sleep, Christopher P. Prior, Homayoun Sadeghi, Andrew J. Turner
  • Patent number: 8946147
    Abstract: Prodrug formulations of insulin and insulin analogs are provided wherein the insulin peptide has been modified by an amide bond linkage of a dipeptide prodrug element. The prodrugs disclosed herein have extended half lives of at least 10 hours, and more typically greater than 2 hours, 20 hours and less than 70 hours, and are converted to the active form at physiological conditions through a non-enzymatic reaction driven by chemical instability.
    Type: Grant
    Filed: June 23, 2011
    Date of Patent: February 3, 2015
    Assignee: Indiana University Research and Technology Corporation
    Inventors: Richard D. DiMarchi, Binbin Kou, Shujiang Cheng
  • Patent number: 8946164
    Abstract: The present invention provides a pharmaceutical or a food that comprises, as an active ingredient, at least one peptide selected from the group consisting of Val-Tyr-Leu-Pro-Arg (SEQ ID NO:1), Tyr-Leu-Pro-Arg (SEQ ID NO:2), and Leu-Pro-Arg (SEQ ID NO:3), or an analog thereof.
    Type: Grant
    Filed: April 6, 2011
    Date of Patent: February 3, 2015
    Assignee: Kyoto University
    Inventors: Kousaku Ohinata, Ayako Oda
  • Patent number: 8946154
    Abstract: Peptide derivatives, their stereoisomers, mixtures thereof and/or their pharmaceutically acceptable salts, a method of obtaining them, pharmaceutical compositions containing them and the use thereof for the treatment, prevention and/or diagnosis of those conditions, disorders and/or pathologies in which the sstr1, sstr2, sstr3, sstr4 and/or sstr5 somatostatin receptors are expressed.
    Type: Grant
    Filed: May 6, 2010
    Date of Patent: February 3, 2015
    Assignee: BCN Peptides, S.A.
    Inventors: Antonio Parente Dueña, Berta Ponsati Obiols, Jimena Fernández Carneado, Marc Gómez Caminals, Ribera Jordana I Lluch
  • Patent number: 8945588
    Abstract: The present invention concerns methods and compositions for treating or preventing a bacterial infection, particularly infection by a Staphylococcus bacterium. The invention provides methods and compositions for stimulating an immune response against the bacteria. In certain embodiments, the methods and compositions involve an Ebh antigen.
    Type: Grant
    Filed: May 7, 2012
    Date of Patent: February 3, 2015
    Assignee: The University of Chicago
    Inventors: Olaf Schneewind, Alice G. Cheng, Dominique M. Missiakas, Hwan Keun Kim
  • Patent number: 8946379
    Abstract: The present invention is directed to bladder cancer specific ligand peptides, comprising the amino acid sequence X1DGRX5GF (SEQ ID NO:1), and methods of their use, e.g., for imaging detection for diagnosis of bladder, tumor localization to guide transurethral resection of bladder cancer, imaging detection of bladder cancer for follow-up after the initial treatment that can replace or complement costly cystoscopy, imaging detection of metastatic bladder cancer, and targeted therapy for superficial and metastatic bladder cancer.
    Type: Grant
    Filed: September 23, 2010
    Date of Patent: February 3, 2015
    Assignee: The Regents of the University of California
    Inventors: Chong-xian Pan, Hongyong Zhang, Kit S. Lam, Olulanu H. Aina
  • Patent number: 8945583
    Abstract: The invention relates to the use of the ubiquitous vertebrate glucose transporter GLUT1, or of fragments or sequences derived thereof, for the in vitro diagnosis of cancers, when used as a tumor marker, or for the screening of compounds useful for the preparation of drugs for the prevention or the treatment of pathologies linked to an infection of an individual with a PTLV, or pathologies linked to an overexpression of GLUT1 on cell surfaces, or the in vitro detection of GLUT1 on cell surfaces. The invention also relates to pharmaceutical compositions containing GLUT1, or fragments or sequences derived thereof, and to their uses such as in the frame of the prevention or the treatment of pathologies linked to an infection of an individual with a PTLV.
    Type: Grant
    Filed: August 26, 2009
    Date of Patent: February 3, 2015
    Assignees: Centre National de la Recherche Scientifique, Universite de Montpellier 2
    Inventors: Jean-Luc Georges Laurent Battini, Nicolas Gabriel Albert Manel, Felix Jinhyun Kim, Sandrina Kinet, Naomi Taylor, Marc Sitbon
  • Patent number: 8945589
    Abstract: This application relates to Group B Streptococcus (“GBS”) vaccines comprising combinations of GBS polypeptide antigens where the polypeptides contribute to the immunological response in a recipient. Preferably, the compositions of the invention comprise a combination of two or more GBS antigens, wherein said combination includes GBS 80 or a fragment thereof. In one embodiment, the combination may consist of two to thirteen GBS antigens selected from an antigen group consisting of GBS 80, GBS 91, GBS 104, GBS 184, GBS 276, GBS 305, GBS 322, GBS 330, GBS 338, GBS 361, GBS 404, GBS 690, and GBS 691.
    Type: Grant
    Filed: September 15, 2004
    Date of Patent: February 3, 2015
    Assignee: Novartis Vaccines and Diagnostics, SRL
    Inventors: John Telford, Guido Grandi, Immaculada Margarit Y Ros, Domenico Maione
  • Publication number: 20150033417
    Abstract: The present invention provides DNA molecules that constitute fragments of the genome of a plant, and polypeptides encoded thereby. The DNA molecules are useful for specifying a gene product in cells, either as a promoter or as a protein coding sequence or as an UTR or as a 3? termination sequence, and are also useful in controlling the behavior of a gene in the chromosome, in controlling the expression of a gene or as tools for genetic mapping, recognizing or isolating identical or related DNA fragments, or identification of a particular individual organism, or for clustering of a group of organisms with a common trait. One of ordinary skill in the art, having this data, can obtain cloned DNA fragments, synthetic DNA fragments or polypeptides constituting desired sequences by recombinant methodology known in the art or described herein.
    Type: Application
    Filed: December 3, 2004
    Publication date: January 29, 2015
    Inventors: Nickolai Alexandrov, Nestor Apuya, Vyacheslav Brover, Jean-Baptiste Dumas, Yiwen Fang, Ken Feldmann, Diane Jofuku, Edward A. Kiegle, Bill Kimmerly, Shing Kwok, Peter Mascia, Jack Okamuro, Roger Pennell, Richard Schneeberger, Tatiana Tatarinova, Wayne Volkmuth
  • Publication number: 20150031564
    Abstract: The present invention improves in vitro virus synthesis efficiency and stability of mRNA derived from screened cDNA in a cDNA display method to improve the efficiency and reliability of the production of a peptide by a molecular evolutionary engineering technique. Provided is a ligand which comprises three fingers formed from antiparallel ?-sheets and a loop region intercalated between the antiparallel ?-sheets, wherein at least a fingertip part formed by the loop region of each of the fingers is bound to the target molecule, and wherein the ligand comprises the amino acid sequence of SEQ ID NO: 1. In the amino acid sequence of SEQ ID NO: 1, X7 represents an arbitrary amino acid residue that constitutes the fingertip part of each of the fingers, each numeric character represents the number of amino acid residues, and X7 and X4 are not composed of the same amino acid residues as each other.
    Type: Application
    Filed: May 16, 2014
    Publication date: January 29, 2015
    Applicants: Saitama University, Nikon Corporation
    Inventors: Naoto Nemoto, Yuuya Yotsumoto
  • Patent number: 8940862
    Abstract: It is an object of the present invention to provide a substance usable as an anticancer agent or DDS, which has intracellular stability, which is capable of evading side effects from functional disorder with respect to normal cells, or which has instantaneous effect. The inventors developed a novel chimeric peptide targeting cancer cells which overexpress EGFR or the like using a binding peptide such as a peptide sequence binding to EGFR, and a lytic peptide sequence, thereby solving such an object. Particularly, by using a chimeric peptide including an EGF receptor-binding peptide or the like and a cytotoxic peptide, this object was solved.
    Type: Grant
    Filed: April 5, 2013
    Date of Patent: January 27, 2015
    Assignees: Stella Pharma Corporation
    Inventors: Koji Kawakami, Masayuki Kohno, Tomohisa Horibe, Oumi Nakajima, Mari Haramoto, Liying Yang
  • Patent number: 8940867
    Abstract: Methods for preparing viral neuraminidase inhibitors including antiviral peptides by specifically chemically modifying disulfide bonds in precursor molecules. A method of inhibiting viral neuraminidases by administering a viral neuraminidase inhibitor comprising an antiviral peptide prepared by the above methods and inhibiting the viral neuraminidase. Therapeutics for inhibiting viral neuraminidases, including effective amounts of viral neuraminidase inhibitors including antiviral peptides derived from selectively chemically modified disuifide bonds in precursor molecules, and present in a pharmaceutically acceptable carriers.
    Type: Grant
    Filed: July 17, 2007
    Date of Patent: January 27, 2015
    Assignee: Nuovo Biologics, LLC
    Inventors: Kent D. Miller, Billy S. Austin
  • Patent number: 8940857
    Abstract: A delivery-enhancing peptide comprising the amino acid sequence of SEQ ID NO:11 or salt thereof. This invention is directed towards methods and compositions to administer a double-stranded ribonucleic acid to a mammal so as to effectuate transfection of the double-stranded RNA into a desired tissue of the mammal.
    Type: Grant
    Filed: August 30, 2010
    Date of Patent: January 27, 2015
    Assignee: Marina Biotech, Inc.
    Inventors: Mohammad Ahmadian, Kunyuan Cui, Lishan Chen, Shu-Chih Chen, Michael E. Houston, Jr.
  • Patent number: 8940703
    Abstract: TIR-domain decoy peptides and TIR domain peptides are disclosed, as well as methods of using the peptides in the regulation of toll-like receptor (TLR) activation and signaling.
    Type: Grant
    Filed: February 7, 2013
    Date of Patent: January 27, 2015
    Assignee: University of Maryland, Baltimore
    Inventor: Vladimir Toshchakov
  • Patent number: 8940299
    Abstract: A method for inducing apoptosis of a neoplastic cell expressing C3aR or C5aR includes administering at least one complement antagonist to the cell so that the at least one complement antagonist substantially reduces or inhibits the activity of protein kinase B in the neoplastic cell.
    Type: Grant
    Filed: March 2, 2009
    Date of Patent: January 27, 2015
    Assignee: Case Western Reserve University
    Inventors: M. Edward Medof, Michael G. Strainic, Young A Choi
  • Patent number: 8940858
    Abstract: The present invention relates to assembly of peptide amphiphiles and biopolymers into fibrous microcapsules, and uses thereof. In particular, the present invention provides devices, compositions, and methods for interfacial self-assembly of peptide amphiphiles and biopolyments into fibrous microcapsules, and uses thereof.
    Type: Grant
    Filed: May 17, 2011
    Date of Patent: January 27, 2015
    Assignee: Northwestern University
    Inventors: Samuel Stupp, Dorota Rozkiewicz
  • Patent number: 8940859
    Abstract: 1,3-Dipole-functional compounds (e.g., azide functional compounds) can be reacted with certain alkynes in a cyclization reaction to form heterocyclic compounds. Useful alkynes (e.g., strained, cyclic alkynes) and methods of making such alkynes are also disclosed. The reaction of 1,3-dipole-functional compounds with alkynes can be used for a wide variety of applications including the immobilization of biomolecules on a substrate.
    Type: Grant
    Filed: March 13, 2012
    Date of Patent: January 27, 2015
    Assignee: University of Georgia Research Foundation, Inc.
    Inventors: Geert-Jan Boons, Jun Guo, Xinghai Ning, Margaretha Wolfert
  • Patent number: 8940863
    Abstract: It is an object of the present invention to provide a substance usable as an anticancer agent or DDS, which has intracellular stability, which is capable of evading side effects from functional disorder with respect to normal cells, or which has instantaneous effect. The inventors developed a novel chimeric peptide targeting cancer cells which overexpress EGFR or the like using a binding peptide such as a peptide sequence binding to EGFR, and a lytic peptide sequence, thereby solving such an object. Particularly, by using a chimeric peptide including an EGF receptor-binding peptide or the like and a cytotoxic peptide, this object was solved.
    Type: Grant
    Filed: April 5, 2013
    Date of Patent: January 27, 2015
    Assignees: Stella Pharma Corporation
    Inventors: Koji Kawakami, Masayuki Kohno, Tomohisa Horibe, Oumi Nakajima, Mari Haramoto, Liying Yang
  • Patent number: 8940685
    Abstract: The present invention discloses a method for producing antihypertensive active peptides with corn germ protein as the material. The method comprises an alkali-heat treatment and continuous enzymolysis of the corn germ protein. The components with molecular weight less than 1000 Da in the active peptides obtained according to the present method account for more than 92%, and alanine-tyrosine (Ala-Tyr, AY) as the characteristic peptide fragments in the antihypertensive peptides accounts for more than 0.6%, so that the active peptides have a good ACE inhibitory activity in vitro as well as stability against temperature, pH and major gastrointestinal digestive enzymes, and have a significant effect of lowering blood pressure on spontaneous hypertension rats in vivo. The active peptides can be applied as a new functional nutrient to development and production of food, health food and pharmaceutical.
    Type: Grant
    Filed: May 14, 2013
    Date of Patent: January 27, 2015
    Assignee: China National Research Institute of Food and Fermentation Industries
    Inventors: Muyi Cai, Ruizeng Gu, Weixue Yi, Jun Lu, Yong Ma, Zhe Dong, Yaguang Xu, Xingchang Pan, Yongqing Ma, Feng Lin, Zhentao Jin, Liang Chen, Lu Lu, Wenying Liu
  • Patent number: 8940506
    Abstract: The disclosure provides method and composition utilizing fluorescent amino acids and endogenous fluorescent proteins comprising a moiety capable of undergoing FRET. The methods and compositions of the disclosure are useful in analyzing protein structure and function, and screening molecular inhibitors.
    Type: Grant
    Filed: March 21, 2009
    Date of Patent: January 27, 2015
    Assignee: The Regents of the University of California
    Inventors: Jiayu Liao, Yang Song, Yongfeng Zhao, Yan Liu
  • Patent number: 8940501
    Abstract: The present invention relates to methods for ligation. The invention provides novel reagents and methods for ligating an acyl donor compound with an acyl acceptor compound. Provided acyl donor compounds comprise a transamidase recognition sequence that allows ligation with a nucleophilic acyl acceptor in the presence of transamidase. The invention further provides kits comprising acyl donor compounds and optionally comprising other reagents for ligation.
    Type: Grant
    Filed: February 1, 2010
    Date of Patent: January 27, 2015
    Assignee: Whitehead Institute for Biomedical Research
    Inventors: Hidde L. Ploegh, John M. Antos, Maximilian Wei-Lin Popp, Carla Guimaraes
  • Patent number: 8940092
    Abstract: The present invention relates generally to nanocomposite materials. The present invention relates more particularly to hybrid fibers as well as devices including them and methods for making them. Accordingly, one aspect of the invention is a hybrid fiber including a plurality of nanowires, each nanowire having a length, a width, and a thickness, the length being at least 10 times the width and at least 10 times the thickness; and a plurality of binder elements, each binder element having a length, a width, and a thickness, each substantially smaller than the average length of the nanowires and at least one of which is less than about 10 nm in dimension, the binder elements being arranged to intercouple individual nanowires. In certain embodiments, the binder elements are carbon nanotubes, and the nanowires are formed from silicon carbide.
    Type: Grant
    Filed: September 26, 2012
    Date of Patent: January 27, 2015
    Assignee: University of Washington through its Center for Commercialization
    Inventors: Woon-Hong Yeo, Kieseok Oh, Kyong-Hoon Lee, Fong-Li Chou, Jae-Hyun Chung
  • Patent number: 8937151
    Abstract: The invention provides compounds, compositions, and methods for the treatment of diseases, disorders, or conditions that are modulated by matrix metalloproteinases (MMPs). The disease, disorder, or condition can include, for example, stroke, neurological disorders, or ophthalmological disorders. The treatment can include administering a compound or composition described herein, thereby providing a prodrug compound that metabolizes to an active MMP inhibitor in vivo. The MMP inhibition can be selective inhibition, for example, selective inhibition of MMP-2, MMP-9, and/or MMP-14. Thus, the invention provides non-mutagenic prodrug compounds of the formulas described herein that result in the inhibition of MMPs upon in vivo administration.
    Type: Grant
    Filed: March 4, 2011
    Date of Patent: January 20, 2015
    Assignee: University of Notre Dame du Lac
    Inventors: Mayland Chang, Shahriar Mobashery, Mijoon Lee
  • Patent number: 8936787
    Abstract: Disclosed herein are peptides and peptide analogs with multiple amphipathic ?-helical domains that promote lipid efflux from cells via an ABCA1-dependent pathway, as well as peptides that activate lipoprotein lipase, and compositions comprising such peptides or combinations thereof. Also provided herein are methods of using multi-domain amphipathic ?-helical peptides or peptide analogs to treat or inhibit dyslipidemic disorders. Methods for identifying non-cytotoxic peptides that promote ABCA1-dependent lipid efflux from cells and activate lipoprotein lipase within cells are also disclosed herein.
    Type: Grant
    Filed: April 14, 2009
    Date of Patent: January 20, 2015
    Assignee: The United States of America as represented by the Secretary, Department of Health and Human Services
    Inventors: Alan T. Remaley, Marcelo J. A. Amar
  • Patent number: 8937156
    Abstract: Compositions and methods for treating subjects with disorders characterized by hyper-proliferating cells such as tumors and cancers are provided. The compositions comprise agents that are combinations of saposin C (or prosaposin-related polypeptides) and phospholips (or inner leaflet components). This anti-tumor agent is administered in the methods of the invention according to a dosing regimen. Administering an agent of the invention results in a positive therapeutic response in a subject with a tumor.
    Type: Grant
    Filed: December 11, 2008
    Date of Patent: January 20, 2015
    Assignee: Children's Hospital Medical Center
    Inventor: Xiaoyang Qi
  • Patent number: 8937218
    Abstract: A transformed soybean plant having a gene encoding a modified seed storage protein introduced therein, obtained by inserting a gene encoding an Alzheimer's disease vaccine to a variable region(s) of a gene encoding a wild-type seed storage protein, is produced, and said vaccine is produced and accumulated in the seeds thereof.
    Type: Grant
    Filed: November 26, 2009
    Date of Patent: January 20, 2015
    Assignee: Hokko Chemical Industry Co., Ltd.
    Inventors: Teruhiko Terakawa, Hisakazu Hasegawa, Masao Ishimoto, Mikio Shoji, Takeshi Kawarabayashi, Yasuko Utsumi
  • Publication number: 20150017202
    Abstract: The invention provides novel immunological adjuvants and methods for identification of such adjuvants. The invention further provides methods and compositions for eliciting an immune response to an immunogen using the novel adjuvants. The adjuvants can be employed with any suitable immunogen, including proteins, peptides, lipids, and carbohydrates. The immunogen can be derived from a virus, a cancer, or a diseased cell. The elicited immune response can be cellular, humoral, or both.
    Type: Application
    Filed: February 11, 2013
    Publication date: January 15, 2015
    Applicant: AV Theapeutics, Inc.
    Inventors: Raj Tiwari, Robert Suriano, Abraham Mittelman, Jan Geliebter
  • Publication number: 20150018516
    Abstract: Disclosed are methods, compositions and uses of conjugates of prodrug forms of 2-pyrrolinodoxorubicin (P2PDox) with antibodies or antigen-binding fragments thereof (ADCs), with targetable construct peptides or with other targeting molecules that are capable of delivering the P2PDox to a targeted cell, tissue or pathogen. Once delivered to the target cell, the ADC or peptide conjugate is internalized, a highly toxic 2-pyrrolinodoxorubicin (2-PDox) is released intracellularly. The P2PDox-peptide or ADC conjugates are of use to treat a wide variety of diseases, such as cancer, autoimmune disease or infectious disease.
    Type: Application
    Filed: September 22, 2014
    Publication date: January 15, 2015
    Inventors: Serengulam V. Govindan, William J. McBride, Nalini Sathyanarayan, Christine Mazza-Ferreira, David M. Goldenberg