Abstract: The invention relates to peptides comprising part or all of a conserved element within a Center-of-Tree (COT) sequence derived from a family of polypeptides encoded by naturally occurring variants of HIV. The invention also relates to immunogenic compositions and vaccines comprising said peptides. The invention also relates to methods for the identification of HIV controller patients based on the detection of the T cells of the patient to mount a cytotoxic T cell response against said peptides and to methods for the identification of immunogenic peptides within a family of variant polypeptides.

Abstract: The present invention discloses cell penetrating peptides and conjugates of a cell penetrating peptide and a cargo molecule.

Abstract: The invention relates to fragments of the DAXX and FADD proteins that inhibit cell apoptosis, in particular cell apoptosis mediated by the Fas receptor. The invention also relates to derivatives of said anti-apoptotic fragments, conjugates comprising said fragments, pharmaceutical compositions comprising said fragments, and to the medical applications of said fragments, derivatives, conjugates, and pharmaceutical compositions thereof in the treatment or prevention of diseases and conditions associated with apoptosis.

Abstract: A protein scaffold based on a consensus sequence of fibronectin type III (FN3) proteins, such as the tenth FN3 repeat from human fibronectin (human Tenascin), including isolated nucleic acids that encode a protein scaffold, vectors, host cells, and methods of making and using thereof, exhibit enhanced thermal and chemical stability while presenting six modifiable loop domains which can be engineered to form a binding partner capable of binding to a target for applications in diagnostic and/or therapeutic compositions, methods and devices.

Abstract: The present invention provides novel kinocidin peptides comprising a C-terminal portion of a kinocidin, wherein the C-terminal portion encompasses an ?-helical secondary structure and further displays antimicrobial activity. The kinocidin peptides of the invention are derived from and correspond to a C-terminal portion of a kinocidin that includes a ?KC core and that can be a CXC, CC, or C class chemokine. Structural, physicochemical and functional properties of this novel class of antimicrobial peptides and amino acid sequences of particular kinocidin peptides are also disclosed. The invention also provides related antimicrobial methods.

Abstract: The present invention aims to present methods to detect nonalcoholic fatty liver disease including nonalcoholic steatohepatitis by using a protein or its partial peptide that differs in presence or absence, or in quantity between healthy human subjects and patients with nonalcoholic fatty liver disease or nonalcoholic steatohepatitis or between patients with fatty liver and nonalcoholic steatohepatitis and further aims to present biomarkers comprising said protein and said partial peptide to be used to detect nonalcoholic fatty liver disease including nonalcoholic steatohepatitis. Specifically, 35 kDa protein fragment consisting of amino acid sequence expressed by Sequence No. 2 and its partial peptide consisting of amino acid sequence expressed by Sequence No. 3 (including its glycated form) of inter-alpha-trypsin inhibitor heavy chain H4 precursor consisting of amino acid sequence expressed by Sequence No.

Abstract: The present invention includes methods of modulating cellular secretory processes. More specifically the present invention relates to modulating or reducing the release of inflammatory mediators from inflammatory cells by inhibiting the mechanism associated with the release of inflammatory mediators from the vesicles or granules in the inflammatory cells in a subject with a chronic inflammatory disease. In this regard, the present invention discloses an intracellular signaling mechanism that illustrates several novel intracellular targets for pharmacological intervention in disorders involving secretion of inflammatory mediators from vesicles in inflammatory cells. MANS peptide and active fragments thereof are useful in such methods.

Abstract: The present invention relates to peptide from 4 to 50 amino acids comprising a phosphorylated pYX1X2X1 motif (SEQ ID NO: 1), wherein each X1 independently is M or Nle and X2 is any amino acid, pharmaceutical compositions comprising said peptide and use thereof for treating cancer.

Abstract: Compositions and methods that are useful for modulating blood vessel formation, as well as methods that provide for the systematic and efficient identification of angiogenesis modulators are described. As discussed in more detail below, a systematic computational methodology based on bioinformatics was used to identify novel peptide modulators of angiogenesis that have been characterized in vitro and/or in vivo.

Abstract: The present invention discloses compositions of peptide inhibitors of protein synthesis, and methods of identifying peptide inhibitors that are capable of inhibiting protein synthesis through an interaction at a stem-loop H18 in 16S rRNA of a 30S ribosomal subunit. Screening methods for peptides are disclosed, in addition to methods of determining the affinity of a test compound for a ribosomal subunit.

Abstract: Complexes containing one or more modular recognition domains (MRDs) and MRDs attached to scaffold's including antibodies are described. The manufacture of these complexes are the use of these complexes to treat and diagnose diseases and disorders are also described.

Abstract: The instant invention comprises a process for the solid phase synthesis of directed epitope peptide mixtures useful in the treatment and diagnosis of protein conformational disorders, such process defined by a set of rules regarding the identity and the frequency of occurrence of amino acids that substitute a base or native amino acid of a known epitope. The resulting composition is a mixture of related peptides for therapeutic use. The invention also pertains to the process of generating antibodies using the directed epitope peptide mixtures as the antigens, and antibodies generated by such process, useful in the treatment and diagnostics of the said protein conformational disorder.

Abstract: The present invention refers to a novel circovirus as causative agent of bone marrow aplasia with haemorrhagic disease in cattle. The present invention provides novel nucleic acid and protein sequences for diagnostic and therapeutic uses.

Abstract: Provided is a multimeric peptide comprising at least two peptide monomers linked to one another, each of the at least two peptide monomers comprising at least 6 consecutive amino acids from the amino acid sequence as set forth in SEQ ID NO: 1, wherein the at least two peptide monomers are each no longer than 30 amino acids, wherein the multimeric peptide is capable of reducing binding of Placenta Immunomodulatory Factor (PLIF) to human leukocytes.

Abstract: The present invention provides a novel cancer-associated antigen that can be used in the treatment and diagnosis of cancer. Further, the invention provides amino acid and nucleic acid sequence of the novel antigen, binding proteins, and immunoconjugates. The invention also relates to diagnostic and therapeutic methods and kits.

Abstract: The present application is directed to a peptides comprising an a-helix forming-amino acid sequence that binds a heat shock protein. Also included is a polypeptide comprising (a) a first peptide portion that comprises an ?-helix-forming amino acid sequence that binds a heat shock protein; and (b) at least one second peptide portion comprising an antigenic amino acid sequence and/or an a-helix-stabilizing amino acid sequence that increases the interaction of the first peptide portion with the heat shock protein. The present application also includes compositions comprising the peptides and/or polypeptides of present application and uses of the peptides and/or polypeptides of the present application for fractionating substances relevant for discovery, research or clinical analysis from a biological sample and as therapeutics.

Abstract: The invention relates to a peptidomimetic of an NPC-1 epitope on the MUC5AC protein which is differentially expressed in pancreatic and colorectal cancer, and diagnostic and therapeutic usages. Further, antibodies that selectively bind the NPC-1 epitope peptidomimetics and may be used in diagnostic and therapeutic methods.

Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Abstract: The present invention provides polypeptide inhibitors of HSP27 kinase, compositions thereof, and methods for using such polypeptides and compositions for various therapeutic uses.

Abstract: The present invention relates to blocking, inhibiting, reducing, antagonizing or neutralizing the activity of IL-22, IL-20, or both IL-20 and IL-22 polypeptide molecules. IL-20 and IL-22 are cytokines that are involved in inflammatory processes and human disease. IL-22RA (zcytor11) is a common receptor for IL-20 and IL-22. The present invention includes anti-IL-22RA antibodies and binding partners, as well as methods for antagonizing IL-22 or both IL-20 and IL-22 using such antibodies and binding partners.

Abstract: The present invention provides methods and materials for treating and preventing autoimmune diseases. In particular, the present invention relates to the discovery that small peptides are capable of interacting with CD40, thereby interfering with the ability of CD40 to interact with CD 154, which is important in inflammation. The present invention also relate to the use of such peptides in reducing the inflammatory response, and in particular, the autoimmune inflammatory response. The present invention also relates to the use of such short peptides to prevent or reverse autoimmune disease, and particular, diabetes, in individuals suffering from such disease. It also relates to methods and materials for detecting T-cells that express CD40 (Th40 cells). Also provided are kits for reducing inflammation, treating autoimmune diseases, or detecting Th40 cells.

Abstract: The present invention relates to isolated Visceral leishmaniasis (VL) antigens that are useful in therapeutic and vaccine compositions for stimulating a VL specific immunological response. The identified antigens are also useful in diagnostic assays to determine the presence of active VL in an individual. Combinations of antibodies raised against these antigens are especially useful in detection of VL infections. Accordingly, the present invention includes polypeptide molecules, nucleic acid molecules, vaccine compositions, diagnostic assays, and methods of diagnosis and monitoring treatment related to these VL antigens.

Abstract: The invention relates to materials and procedures for the use of the hepcidin binding domain (HBD) on ferroportin. A 20 amino acid peptide of the HBD was synthesized and shown to recapitulate the characteristics and specificity of hepcidin binding to cell surface ferroportin. The affinity of hepcidin for the HBD peptide permits a rapid, sensitive assay of hepcidin in biological fluids.

Abstract: The invention relates to polypeptides, comprising repeats of peptides derived from apolipoproteins, which exhibit antibacterial activity and to nucleic acids encoding the same. The invention further provides the use of such polypeptides, derivatives, analogues or nucleic acids as medicaments, and also their use in methods of preventing or treating bacterial infection or objects and surfaces. The invention further extends to objects, such as contact lenses, coated with the polypeptides.

Abstract: The present invention presents new insights in the mechanism of action of the estrogen receptor alpha in breast cancer cells and provides means and tools for modulating said mechanisms of action, thereby influencing the proliferation of estrogen-positive cells such as cancer cells.

Abstract: The invention relates to a newly identified avian rotavirus D VP6 nucleotide sequence and uses thereof.

Abstract: An object of the invention is to provide a peptide based on a sequence of an amyloid ? peptide that may allow for induction of enhanced immune response and is safe and efficacious for prophylaxis and treatment of Alzheimer disease. An amyloid ? peptide or a portion thereof with addition or insertion of cysteine or a cysteine analogue, and a method for enhancing immune response to amyloid ? using said peptide, a medicament for prophylaxis and treatment of Alzheimer disease using said amyloid ? peptide that induces an enhanced immune response, and a DNA vaccine comprising a gene coding for an amyloid ? peptide or a sequence derived from an amyloid ? peptide with addition or insertion of cysteine or a cysteine analogue, as expected to be similarly efficacious.

Abstract: The present invention provides a marker capable of detecting insulin resistance and diabetes in a collected blood sample, a method for analyzing said marker, a method for screening a substance improving insulin resistance, and improving or suppressing diabetes. A blood insulin resistance marker and a blood diabetes marker, which comprises a polypeptide comprising at least 15 continuous amino acids in an amino acid sequence constituting progranulin. A method for analyzing a blood marker, which comprises the steps of: measuring a concentration of an insulin resistance marker or a diabetes marker in a collected blood sample; and comparing the measured concentration with a normal blood concentration of the marker.

Abstract: The invention relates generally to compounds which are allosteric modulators (e.g., positive and negative allosteric modulators, and allosteric agonists) of the G protein coupled receptor for stromal derived factor 1 (SDF-I), also known as the CX-CR4 receptor. The CXCR4 receptor compounds are derived from the intracellular loops and domains of the CXCR4 receptor. The invention also relates to the use of these CXCR4 receptor compounds and pharmaceutical compositions comprising the CXCR4 receptor compounds in the treatment of diseases and conditions associated with CXCR4 modulation such as bone marrow trans-plantation, chemosensitization, cancer, metastatic disease, inflammatory diseases, HIV infection and stem cell-based regenerative medicine.

Abstract: The present invention provides compositions and methods for killing or suppressing growth of Gram-negative bacteria that infect, infest or cause disease in plants, including pathogenic, saprophytic and opportunistic microbes that cause disease in plants and food borne illness in people or in animal feed.

Abstract: Nucleic acids encoding a new family of small cysteine rich soluble proteins, from a mammal, reagents related thereto, including specific antibodies, and purified proteins are described. Methods of using said reagents and related diagnostic kits are also provided.

Abstract: The present invention relates to compositions and methods of use thereof for cancer therapy sensitization. Such compositions comprise functional fragments of the nucleotide and/or polypeptide sequences of a Secreted Protein Acidic and Rich in Cysteine (SPARC). The compositions can be used in combination with existing chemotherapeutic agents for treatment of cancers.

Abstract: The object of the present invention is to provide an anti-tumor agent having an anti-angiogenic effect and/or an anti-tumor growth effect or a method for tumor growth inhibition. The present invention provides an anti-tumor agent characterized by having an anti-angiogenic effect and/or an anti-tumor growth effect, which contains a polypeptide of galactosylceramide expression factor-1 excluding the Q region, wherein the polypeptide comprises at least the C region or a part thereof.

Abstract: The invention relates to the discovery that HNA-3a and HNA-3b are antigens within a polypeptide sequence that is highly similar to the CTL2 amino acid sequence.

Abstract: The invention relates to thrombin inhibitors derived from the salivary glands of haematophagous arthropods and in particular to bivalent and trivalent thrombin inhibitors that act by interacting with thrombin at two or three different sites.

Abstract: Peptides and methods of use thereof are provided.

Abstract: The present invention concerns a system, comprising bacteriophages and particles comprising active agents, in which a first additional peptide is fused to proteins of the bacteriophage, the first additional peptide adheres to the surface of the particle and furthermore a second additional peptide is fused to proteins of the bacteriophage. The second additional peptide can adhere on substrate surfaces. The present invention furthermore concerns the use of the system for delayed release of active agents and also a method for production of the system. The present invention furthermore concerns a method for the selection of phage species from a combinatorial phage population.

Abstract: The invention provides a delivery system comprising a cell penetrating peptide, 10 histidines, and an interfering RNA molecule. The system can be used for delivering interfering RNA molecules into a cell in vivo or in vitro. Therapeutic uses for the delivery system are also provided.

Abstract: Peptide-based reagents comprising at least one tooth surface-binding peptide for delivery of at least one polymer-coated white colorant to the surface of teeth are provided. The peptide-based reagent may comprise at least one tooth-binding peptide coupled to, either directly or through one or more spacers, a polymer-binding peptide capable of binding to the polymeric coating on a polymer-coated white colorant. Methods of delivering a polymer-coated white colorant to a tooth surface are also provided as well as oral care compositions comprising the present peptide-based reagents. The peptide-based reagents may be used in conjunction with at least one polymer-coated white colorant to improve the cosmetic appearance of teeth.

Abstract: The invention provides methods for treating stroke and compositions for use in the same. The methods employ a chimeric peptide of an active peptide and an internalization peptide. The internalization peptide is a tat variant that promotes uptake of itself and a linked active peptide into a cell without substantial binding to N-type calcium channels. Use of the tat variant allows treating of stroke free of certain side effects associated with binding to N-type calcium channels. Tat variant peptides can also be linked to other active agent for use in treating other diseases.

Abstract: The present invention provides novel peptides that can modulate the ghrelin receptor (growth hormone secretagogue receptor, GHS-R1a and sub-types, isoforms and variants thereof). These peptides are useful as antagonists of the ghrelin receptor as well as inverse agonist, partial agonist or a combination of these activities as medicaments for treatment and prevention of a range of medical conditions including, but not limited to, metabolic and/or endocrine disorders, gastrointestinal disorders, cardiovascular disorders, obesity and obesity-associated disorders, diabetes, central nervous system disorders, genetic disorders, and hyperproliferative disorders.

Abstract: The present invention provides a screening method for identifying a peptide capable of inducing a T cell response comprising: a) contacting a peptide having a level of identity with a sequence of a protein of a virus, with a test sample comprising T cells obtained from blood from a subject who is currently or has been recently infected with the virus, b) quantifying the response of the T cells to the peptide, c) comparing the T cells' response in b) to a response of a control sample comprising T cells obtained from blood from a subject who is not currently infected nor been recently infected with the virus, when contacted with the peptide, wherein a greater response to the peptide in b) than in c) is indicative of a peptide capable of inducing a T cell response.

Abstract: The present invention relates to peptides or fragments thereof, which peptides bind to mesenchymal stem cells. The present invention also relates to a method for identifying, isolating, specifically selecting and/or enriching mesenchymal stem cells, wherein the peptides, or fragments thereof, are employed for specifically binding to the mesenchymal stem cells. Also, the present invention relates to the use of the peptides of the invention, or fragments thereof, and of the mesenchymal stem cells isolated with the peptides of the invention, or fragments thereof, for treating, injuries and/or degenerated bone, cartilage or tissues.

Abstract: The invention relates to conjugates that bind to Her2/neu, methods of using conjugates that bind to Her2/neu and methods of treating undesirable or aberrant cell proliferation or hyperproliferative disorders, such as tumors, cancers, neoplasia and malignancies that express Her2/neu.

Abstract: The invention provides polypeptides comprising an amino acid sequence comprising at least one variation from wild-type HCV NS5B polymerase, the at least one variation selected from the group consisting of cysteine, isoleucine, valine, or proline at amino acid position 419; alanine, valine, or asparagine at amino acid position 482; valine, isoleucine, threonine, or serine at amino acid position 486; and isoleucine at amino acid position 494, as the amino acid positions are defined in SEQ ID NO: 1, and having Hepatitis C Virus (HCV) NS5B polymerase activity. Polynucleotides encoding the polypeptide, antibodies, host cells, compositions, and methods for detecting an HCV NS5B polymerase having resistance to a polymerase inhibitor also are provided.

Abstract: An immunopeptide containing a T cell epitope from the tumor associated antigen L6 (TAL6) and a nucleic acid encoding the immunopeptide are described herein. The immunopeptide or its encoding nucleic acid can be used as a component of an immune composition for enhancing immune response against cancer cells that express TAL6.

Abstract: The invention relates to a peptide of 8-50 amino acids comprising the sequence of KAHKKRAD or KARKKHAD, or a cyclic peptide of 8-50 amino acids comprising the sequence of HKKR or RKKH. Also disclosed are methods of using the peptide for detecting, monitoring, or treating cancer.

Abstract: The present invention provides a peptide of the following (A) or (B): (A) a peptide including an amino acid sequence of SEQ ID NO: 1 or 2; (B) a peptide including an amino acid sequence of SEQ ID NO 1 or 2, wherein one, two, or several amino acid(s) are substituted, deleted, inserted, and/or added, and wherein the peptide has an activity to induce killer T cells.

Abstract: A collagen peptide with immune-enhancing activity from Cyanea nozakii, and a preparation method thereof are provided. The collagen peptide contains 80-90 wt % of proteins and 10-20 wt % of sugars, and has an average molecular weight of 1,000-3,000 Dalton. Monosaccharide contained in the collagen peptide are mainly glucose, glycine accounts for 16% or above and the sum of proline and hydroxyproline accounts for 18% or above of amino acids contained therein. The collagen peptide is capable of being used for preparation of medicines, health products, and skincare cosmetics having immune-enhancing function.

Abstract: The invention relates to compositions and methods for the detection of various infectious organisms, including heartworm (Dirofilaria immitis), Ehrlichia Canis, Anaplasma phagocytophilum, and Borrelia burgdorferi. More particularly, this invention relates to antibodies that bind to a heartworm antigen, the E. Canis gp36 polypeptide, the A. phagocytophilum p44 polypeptide, the B. burgdorferi OspA, OspC, OspF, p39, p41 and VlsE polypeptides, and uses thereof.