Abstract: A connecting device for connecting a table leg to a table leaf having a back-gripping element, which can be disposed on the table leaf and has an engagement hole and a locking device, which can be disposed on the table leg. The locking device has a clamping element having an engagement hook which is designed to engage the engagement hole of the back-gripping element, a spring element, which is supported at least indirectly against the clamping element and at least indirectly against a spring abutment, and an actuating element. The actuating element acts on the spring abutment so that, in a locking position, the spring abutment applies sufficient force to secure the engagement hook of the clamping element in the engagement hole, and in an unlocking position, the spring abutment is in a position in which the spring element is at least partially unloaded in relation to the locking position.

Abstract: A support mechanism for mounting a seat part to a foot part of a functional chair having a slide bearing which cooperates with a front section of the seat part, and a pivotable support part which is supported by a cantilever part and which is connected to a region of the seat part that is adjacent to the rear region of a seat surface section of the seat part.

Abstract: A substantially pure polypeptide (human NESP55) comprising the amino acid sequence (SEQ ID NO: 2) IRLEVPKRMDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALL RALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEAD LELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPE DDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGE ELKPEDKDPRRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIP IRRH or a variant, fragment, fusion or derivative thereof, or a fusion of a said variant or fragment or derivative, wherein the polypeptide variant has an amino acid sequence which has at least 90% identity with the amino acid sequence given above. NESP55 or fragments thereof may be useful in medicine for the treatment of obesity.

Abstract: An administration form for the release of collagenase to wounds is characterised in that it exhibits a combination of specific properties as hereinbelow:a. it is coherent, flat-shaped and deformable;b. it has a superficial extension that is equal to or smaller than the wound surface to be treated;c. it comprises collagenase in defined amounts in homogeneously distributed form;d. it is designed for the controlled release of collagenase.

Abstract: A process for producing solutions of active substances of low solubility, which comprises (1) dissolving the active substance with a phospholipid and a water-soluble lipid in an organic solvent, (2) evaporating the resulting solution to dryness, (3) taking up the residue in a strongly acidic buffer and stirring at elevated temperature until a colloidal solution is produced, (4) cooling the colloidal solution and adjusting to a pH of 6-7 and sterilizing. Particularly suitable for the process are lipids of the formula ##STR1## wherein m, a, b, x and y have the meanings indicated in the description.

Abstract: Nucleic acid molecules and proteins useful for regulating the expression of genes in eukaryotic cells and organisms in a highly controlled manner are disclosed. In the regulatory system of the invention, transcription of a tet operator-linked nucleotide sequence is inhibited by a transcriptional inhibitor fusion protein composed of two polypeptides, a first polypeptide which binds to tet operator sequences either (i) in the absence but not the presence of tetracycline (or an analogue thereof) or (ii) in the presence but not the absence of tetracycline (or an analogue thereof), and a second polypeptide which directly or indirectly inhibits transcription in eukaryotic cells. In one embodiment, the fusion protein comprises a Tet repressor operatively linked to a transcriptional silencer polypeptide. In another embodiment, the fusion protein comprises a mutated Tet repressor operatively linked to a transcriptional silencer polypeptide.

Abstract: A process for preparing an aqueous active substance solution which can be sterilized by filtration entails mixing anipamil hydrochloride with a phospholipid in the ratio of from 1:2 to 2:1 by weight, converting the resulting mixture into a gel by adding water at elevated temperature, and subsequently adding water to the gel at elevated temperature until the active substance is present in the required concentration.

Abstract: The monohydrochloride and the monomethanesulfonate of amonafide are described. The salts have good pharmaceutical properties besides their antitumor action.

Abstract: .alpha.-Aminocarboxylic acid derivatives of the formula: ##STR1## where n, X, Y and Z have the meanings stated in the description, and their preparation are described. The compounds are used in a method for improving delivery and reducing toxicity of biologically active substances by encapsulation of the biologically active substance with the above compounds.

Abstract: A solid drug form containing not less than 90% by weight verapamil is produced by granulating at from 30.degree. to 55.degree. C. with a little water, drying and, where appropriate, conventional tableting or by pelleting, in which case the granules obtained as described are, after cooling, moistened once again and compacted in a granulating mixer at from 30.degree. to 55.degree. C. and are dried.

Abstract: A process is described for the production of solid forms of active substances, which forms have good redispersibility in aqueous systems, which comprises mixing PEG and dextran with water and--if phase separation occurs--removing the upper phase, dissolving an active substance in the mixture, where appropriate adding a physiologically tolerated amphiphile, and subsequently removing the water.

Abstract: The use of nor-verapamil and nor-gallopamil and the salts thereof with physiologically tolerated acids is disclosed for the preparation of drugs with antiarteriosclerotic properties.

Abstract: TNF and LT are used for the prophylaxis and therapy of effusions in body cavities.

Abstract: A mixture of an alginate and a polyacrylate in a ratio of from 15:1 to 1:2 is suitable for the preparation of depot drug forms.

Abstract: TNF and LT are used for the prophylaxis and therapy of effusions in body cavities.

Abstract: An alginate-based depot drug form for which the rate of release of the active substance in vitro can be adjusted very precisely is described.

Abstract: A method for preventing digestive disturbances in herbivores entails supplementing their feed with adequate amounts of pancreatin which has preferably been given a neutral taste.

Abstract: Hydroxypropafenone glycerides of the formula I ##STR1## where R is n-propyl or 1,1-dimethylpropyl,x is 2 or 3,y is 12, 14, 16, 18 or 20, anda and b differ from one another and are 0 or 1,as well as the stereoisomers thereof and the preparation thereof are described. The compounds are suitable as active substances for antiarrhythmics.

Abstract: Combinations of calcium antagonists and lipid-lowering agents are suitable for controlling diseases.

Abstract: The use of (S)-emopamil and the salts thereof for the treatment of migraine is described.