Abstract: A skin care composition that includes a combination of palmitoyl dipeptide-7, acetyl tetrapeptide-11, other optional skin ingredients, and a dermatologically acceptable carrier. The combination of peptides synergistically improves cellular ATP level and/or upregulates the expression of peroxisome proliferator activated receptor alpha and/or methylsterol monooxygenase 1 to help provide improved skin health and appearance.

Abstract: Modified release formulations of gamma-hydroxybutyrate having improved dissolution and pharmacokinetic properties are provided, and therapeutic uses thereof.

Abstract: The present invention relates to a method for preparing immediate and sustained release solid dosage forms, comprising antibodies and functional fragments thereof, by solution/suspension layering, optionally coated with a delayed release coating; the solid dosage forms prepared by the method; and the use of the solid dosage forms in the topical treatment in the gastrointestinal tract of a patient.

Abstract: Modified release formulations of gamma-hydroxybutyrate having improved dissolution and pharmacokinetic properties are provided, and therapeutic uses thereof.

Abstract: PYY analogs are disclosed that include modifications that increase half-life when compared to native, human PYY, as well as additional modifications that increase potency and selectivity to the NPY2 receptor. Pharmaceutical compositions also are disclosed that include one or more of the PYY analogs described herein in a pharmaceutically acceptable carrier. Methods of making and using the PYY analogs also are disclosed, especially for treating obesity and obesity-related diseases and disorders such as type II diabetes mellitus.

Abstract: Compositions and methods for the inhibiting human growth hormone (hGH), and treating or preventing hGH-mediated disorders, using a S1H peptide having the amino acid sequence of [SEQ ID NOs: 1-25], or a variant thereof, are described.

Abstract: Provided herein are cyclic polypeptide compounds that can, e.g., bind specifically to human proprotein convertase subtilisin/kexin type 9 (PCSK9) and optionally also inhibit interaction between human PCSK9 and human low density lipoprotein receptor (LDLR), and pharmaceutical compositions comprising one or more of these compounds. Also provided are methods of reducing LDL cholesterol level in a subject in need thereof that include administering to the subject one or more of the cyclic polypeptide compounds or a pharmaceutical composition provided herein.

Abstract: The present invention provides novel nanostructures comprising solution of PPSU20. Methods of preparing the novel PPSU nanostructures, and applications of such nanostructures are also provided.

Abstract: The present invention relates to novel injectable presentations, kits or syringes comprising a composition with sustained or controlled release of lanreotide or one of the salts thereof. The compositions of lanreotide or one of the salts thereof are packaged in a syringe having a diameter greater than 3.00 mm and provided with a needle having an outer diameter no greater than 1.00 mm.

Abstract: Disclosed herein are novel synthetic polypeptides and uses thereof in the preparation of liposomes. According to embodiments of the present disclosure, the synthetic polypeptide comprises a membrane lytic motif, a masking motif, and a linker configured to link the membrane lytic motif and the masking motif. The linker is cleavable by a stimulus, such as, light, protease, or phosphatase. Once being coupled to a liposome, the exposure to the stimulus cleaves the linker that results in the separation of the masking motif from the membrane lytic motif, which in turn exerts membrane lytic activity on the liposome that leads to the collapse of the intact structure of the liposome, and releases the agent encapsulated in the liposome to the target site. Also disclosed herein are methods of diagnosing or treating a disease in a subject by use of the present liposomes.

Abstract: Modified release formulations of gamma-hydroxybutyrate having improved dissolution and pharmacokinetic properties are provided, and therapeutic uses thereof.

Abstract: Disclosed is a sanitizing/disinfecting composition containing a quaternary ammonium compound and a polybiguanide. The composition is a food contact safe composition which does not need rinsing after being applied to a substrate. The composition may be saturated into a wipe.

Abstract: Methods for the synthesis of arginine-containing peptides are provided. The methods include a deprotection step that minimizes the transfer of by-products deriving from cleaved sulfonyl-5 based side chain protecting groups from arginine to amino acids carrying electron rich side chains.

Abstract: Compositions of particles having at least 95% by weight of rucaparib and a specific surface area (SSA) of at least 12 m2/g, methods for their use, and methods for their production are provided.

Abstract: The present invention provides the peptide nucleic acid derivative which targets 5? splice site of the human ACC2 pre-mRNA “exon 12”. The peptide nucleic acid derivatives in the present invention strongly induce splice variants of the human ACC2 mRNA in cell and are very useful to treat conditions or disorders of skin aging associated with the human ACC2 protein.

Abstract: Methods for treating psychiatric and psychological diseases or conditions, including depression, by use of L-tryptophan or a derivative or analog thereof and a derivative of phyllokinin are described. The methods can be used together with other agents for treatment of depression or other psychiatric or psychological diseases or conditions. Pharmaceutical compositions comprising at least one of L-tryptophan or a derivative or analog thereof and a derivative of phyllokinin together with a pharmaceutically acceptable excipient are also described. The pharmaceutical compositions can include other therapeutically active agents for the treatment of psychiatric or psychological diseases or conditions such as depression.

Abstract: Disclosed herein are GDF11 variant polypeptides. Also disclosed herein are methods for increasing GDF11 protein levels in a subject by administering a GDF11 variant polypeptide.

Abstract: Methods for regulating multiple organs, multiple genes and multiple targets by using a polypeptide. The polypeptide includes the amino acid sequence of SEQ ID No. 1 and/or homology thereof. The polypeptide reveals the potency to regulate transcription of multiple genes and expression of multiple targets. Therefore, a composition having the polypeptide can be applied to regulate the expression of multiple targets in multiple organs of patients. Furthermore, the composition having the polypeptide can be applied in therapies of inflammation and inflammatory disorders, suppression of fatty liver disease progression, suppression of the diseases caused by fatty accumulation, prevention and therapy of muscular atrophy, and avoiding the complications of diabetes.

Abstract: The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.

Abstract: Engineered, non-naturally occurring antimicrobial NCR13 variant peptides (NVPs), or agriculturally acceptable salts thereof, are described, along with methods of making and using the same. The present disclosure is also related to and describes novel antimicrobial compositions, formulations, and methods of using the same, that are useful for the control of pathogenic microbes.