Abstract: The present disclosure provides, among other things, compositions (e.g., autoantibodies) that inhibit the growth, viability, or mobility of (invasion by) a cancer cell. Also provided are applications, such as therapeutic and diagnostic methods, in which the agents are useful, as well as screening methods for identifying autoantibodies useful in the applications.

Abstract: This disclosure provides nano-scale Artificial Antigen Presenting Cells (aAPC), which deliver stimulatory signals to lymphocytes, including T-helper lymphocytes, for use as a powerful tool for immunotherapy.

Abstract: The present technology relates generally to dry powder formulations of antibodies specific for thymic stromal lymphopoietin (TSLP), as well as methods of treating asthma, using the dry powder formulations, suitably via pulmonary delivery.

Abstract: Anti-CD59 and anti-glycated CD59 antibodies are disclosed. Assays, diagnostics, kits, and assay components including such antibodies are provided. Methods for the assessment of diabetes-related indications are included as well as inhibitors of CD59 glycation and methods of evaluating such inhibitors.

Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Abstract: Disclosed are methods and compositions for determining immunodominant peptides of target enzymes used in enzyme replacement therapy for lysosomal storage disorders. More specifically disclosed are immunodominant peptides for N-acetylgalactosamine-6-sulfatase (GALNS). Also disclosed are methods of inducing oral tolerance towards a target enzyme through oral administration of immunodominant peptides prior to commencing enzyme replacement therapy. More specifically disclosed is a method of inducing oral tolerance for GALNS, by orally administering specific immunodominant peptides for GALNS; in subjects suffering from mucopolysaccharidosis type IVA prior to commencing enzyme replacement therapy using GALNS.

Abstract: Provided are an artificial multi-antigen fusion protein and a preparation method thereof. The fusion protein can effectively stimulate CD8+T and CD4+ T cell immunities, and can be applied to immunodiagnostics or serve as a prophylactic or therapeutic vaccine.

Abstract: Provided herein is technology relating to immunotherapy and particularly, but not exclusively, to compositions, methods, and kits for immunotherapy and activation of T cells using a peptide-major histocompatibility complex (pMHC) assembled on a protein scaffold for patterned signal presentation of T cell activating ligands to T cells.

Abstract: The present invention provides a preventive or therapeutic method for an inflammatory skin disease, such as psoriasis, the method comprising administering an oligopeptide as an active ingredient. More specifically, the invention provides a preventive or therapeutic method for an inflammatory skin disease, the method comprising administering an oligopeptide consisting of an amino acid sequence containing a DE loop sequence of RANKL protein and a ?-strand D sequence of RANKL protein placed adjacent to the N-terminal side of the DE loop sequence.

Abstract: Methods and compositions for promoting donor-specific tolerance and immunocompetence to a recipient of a solid organ transplant, by implanting an allogeneic solid organ in a recipient in need of a solid organ transplant and further comprising surgical implantation of a tissue-engineered allogeneic cultured postnatal thymus tissue product in the recipient of a solid organ from a donor.

Abstract: The invention provides isolated primate cells preferably human cells that comprise a genetically engineered disruption in a beta-2 microglobulin (B2M) gene, which results in deficiency in MHC class I expression and function. Also provided are the method of using the cells for transplantation and treating a disease condition.

Abstract: The present invention relates to, in part, artificial antigen presenting cells that are useful in treating disease (including cancers) and have uses, for example, directly in vivo and/or in the expansion of a patients cells for re-introduction ex vivo.

Abstract: A composition including a supernatant obtained from co-culture of phagocytes with apoptotic cells. The composition is obtained by a) providing phagocytes, b) providing apoptotic cells, c) optionally washing the cells from step a) and b), d) co-culturing the cells of step a) and b), and e) separating the supernatant from the cells. The composition may be used in preventing or treating a pathological immune response.

Abstract: The present invention relates to a method for producing natural killer cells using T cells, and more particularly, to a method for producing natural killer cells, which comprises culturing seed cells using CD4(+) T cells as feeder cells. The method for producing natural killer cells using T cells according to the present invention is a method capable of producing natural killer cells by selectively proliferating only natural killer cells from a small amount of seed cells while maintaining the high killing activity of the natural killer cells. The method of the present invention can produce a large amount of natural killer cells that can be frozen, and thus is useful for commercialization of cell therapeutic agents.

Abstract: Antibodies, or antigen-binding fragments thereof, that bind to Lymphocyte-activation gene-3 (LAG-3) are described, in particular antibodies, or antigen-binding fragments thereof, that are agonists of LAG-3. The antibodies bind to LAG-3 and inhibit antigen-induced CD4+ and/or CD8+ T cell proliferation, or antigen-induced CD4+ and/or CD8+ T cell activation. The antibodies may be used as medicaments, in particular for the treatment of conditions associated with proliferation and/or activation of CD4+ and/or CD8+ T cells, such as inflammatory and autoimmune disorders.

Abstract: The disclosure relates to biomarkers of rheumatoid arthritis, e.g., PTPN22, PFKFB3, ATM, IL-17A, and IL-17F, and methods of using these biomarkers for selecting an effective treatment for rheumatoid arthritis.

Abstract: A method of treating skin diseases by administering a pharmaceutical composition including a humanized antibody which binds to vimentin.

Abstract: The present disclosure concerns methods and compositions related to cancer treatment comprising targeting of SRC-3 in immune cells, including T cells such as T regulatory cells. The targeting of SRC-3 in T regulatory cells in particular is effective to eradicate tumors in mammals. In specific cases, the T regulatory cells are subjected to CRISPR ex vivo to produce cells suitable for adoptive cell transfer. In some cases, one or more agents that target SRC-3 are also administered to the individual and/or are exposed to the cells prior to administration.

Abstract: This document provides methods and materials involved in assessing mammals (e.g., humans) for arthritis. For example, methods and materials for assessing a mammal's gut microbial diversity to identify the mammal as having arthritis (e.g., rheumatoid arthritis) are provided. This document also provides methods and materials involved in treating arthritis.

Abstract: The present disclosure concerns methods and compositions related to cancer treatment comprising targeting of SRC-3 in immune cells, including T cells such as T regulatory cells. The targeting of SRC-3 in T regulatory cells in particular is effective to eradicate tumors in mammals. In specific cases, the T regulatory cells are subjected to CRISPR ex vivo to produce cells suitable for adoptive cell transfer. In some cases, one or more agents that target SRC-3 are also administered to the individual and/or are exposed to the cells prior to administration.