Patents Examined by Sergio Coffa
-
Patent number: 11820837Abstract: The present disclosure relates to a modified peptide including (i) an amino acid sequence (X)-GRT-(Y)-TLC-(Z), or (ii) an amino acid sequence having at least 40% sequence identity to the amino acid sequence (X)-GRT-(Y)-TLC-(Z), wherein X, Y, and Z are the same as described in the specification. In this regard, methods for inhibiting the activity of at least one enzyme selected from the group consisting of AKT1 (PKB alpha), AKT2 (PKB beta), MAP3K8 (COT), MST4, AURKB (Aurora B), ROCK1, RPS6KB1 (p70S6K), CDC42 BPA (MRCKA), BRAF, RAF1 (cRAF) Y340D Y341D, SGK (SGK1), MAP4K4 (HGK), AURKA (Aurora A), AURKC (Aurora C), BRAF V599E, CHEK1 (CHK1), GSG2 (Haspin), CHEK2 (CHK2), FGR, IKBKB (IKK beta), CDK7/cyclin H/MNAT1, and CDC42 BPB (MRCKB) and Abl; and inhibiting cell proliferation are also provided, as are methods for preventing or treating cancer or a neurodegenerative disease or disorder.Type: GrantFiled: June 3, 2020Date of Patent: November 21, 2023Assignee: Advanced Technologies for Novel Therapeutics, LLCInventor: Effat S. Emamian
-
Patent number: 11752132Abstract: The subject invention provides therapeutic compositions, and uses thereof for the treatment or amelioration of injury to small intestine mucosa. In preferred embodiments, the composition comprises one or more nutrients and/or electrolytes that acquire or retain considerable absorptive capacity.Type: GrantFiled: January 29, 2021Date of Patent: September 12, 2023Assignee: UNIVERSITY OF FLORIDA RESEARCH FOUNDATION, INCORPORATEDInventors: Sadasivan Vidyasagar, Paul Okunieff, Lurong Zhang
-
Patent number: 11718654Abstract: IL-2R??c binding compounds, and pharmaceutical compositions comprising the IL-2R??c binding compounds are disclosed. IL-2R??c binding compounds can act as IL-2R agonists and are useful in treating cancer, autoimmune diseases and inflammatory diseases.Type: GrantFiled: November 4, 2020Date of Patent: August 8, 2023Assignee: MEDIKINE, INC.Inventors: William J. Dower, Michael C. Needels, Ronald W. Barrett, Alice V. Bakker, Steven E. Cwirla
-
Patent number: 11713344Abstract: A novel peptide analog of acylated oxyntomodulin and its uses are disclosed. A pharmaceutical composition containing the novel peptide analog is useful and effective for preventing and treating obesity or overweightness, or diabetes accompanied by obesity and overweightness. The peptide analog and a composition containing the peptide analog are superior to those of wild-type oxyntomodulin in dual agonism on GLP-1 and glucagon receptors and longer in vivo half-life. A pharmaceutical composition containing the peptide analog is effective in the treatment of metabolic diseases such as obesity and diabetes mellitus.Type: GrantFiled: August 24, 2021Date of Patent: August 1, 2023Assignee: DONG-A ST CO., LTD.Inventors: Jae-Sung Yang, Kyung-Seok Lee, Yu-Na Chae, Gye-Rim Baek, Tae-Hyoung Kim, Ill-Hun Jung, Chae-Lim Ryu, Weon-Bin Im
-
Patent number: 11707505Abstract: The present invention further relates to using vaccinia virus complement control protein (VCP), factor H and/or a complement control protein (CCP)-containing protein as modulator of the entry and/or replication of pathogen(s), wherein the pathogen is a virus or bacteria. The present invention further relates to a method of prevention and/or treatment of influenza A virus (IAV) infection in a subject of need thereof and to a method of modulation of the entry and/or replication of pathogen(s) in a subject of need thereof.Type: GrantFiled: November 15, 2019Date of Patent: July 25, 2023Assignee: KING FAISAL SPECIALIST HOSPITAL & RESEARCH CENTREInventors: Futwan Al-Mohanna, Uday Kishore, Katharine Collison, Valarmathy Murugiah, Soad Saleh, Praveen Mathews Varghese
-
Patent number: 11667675Abstract: The present invention relates to novel Mannose-binding lectin (MBL)-associated serine protease (MASP) inhibitory compounds, as well as analogues and derivatives thereof, to processes for the preparation thereof, to the use thereof alone or in combinations for treatment and/or prevention of diseases and to the use thereof for production of medicaments for treatment and/or prevention of diseases, especially for treatment and/or prevention of renal and cardiovascular disorders and of ischemia reperfusion injuries.Type: GrantFiled: December 30, 2020Date of Patent: June 6, 2023Assignees: Bayer Aktiengesellschaft, Bayer Pharma AktiengesellschaftInventors: Donald Bierer, Ingo Flamme, Dmitry Zubov, Thomas Neubauer, Adrian Tersteegen, Cathleen Juhl, Marie Glatz, Jan Dreher, Simon Holton, Carsten Terjung, Lars Baumann, Thorsten Poethko, Jiancheng Xiong, Yibo Qiu
-
Patent number: 11661440Abstract: The invention provides a series of peptides with N-methyl-D-aspartate (NMDA) receptor modulating activity. Specifically it contains two synthetic peptides acting as ion inflow antagonists through the NMDA receptor with specificity GluN2B and GluN2A NMDA receptor subunits and a peptide having agonist activity regarding the NMDA receptor in rat hippocampal neuron cultures.Type: GrantFiled: January 11, 2021Date of Patent: May 30, 2023Assignee: Universidad Nacional de ColombiaInventors: Edgar Antonio Reyes Montaño, Edwin Alfredo Reyes Guzmán, Nohora Angélica Vega Castro
-
Patent number: 11648289Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.Type: GrantFiled: October 1, 2020Date of Patent: May 16, 2023Assignee: NORWEGIAN UNIVERSITY OF LIFE SCIENCESInventors: Dzung B. Diep, Kirill V. Ovchinnikov, Per E. Kristiansen, Ingolf F. Nes, Tage Thorstensen
-
Patent number: 11648323Abstract: A composition for use in diagnostic and therapeutic applications includes a heteromultivalent nanoparticle or microparticle having an outer surface and a plurality of targeting moieties conjugated to the surface of the nanoparticle or microparticle, the targeting moieties includes a first activated platelet targeting moiety and a second activated platelet targeting moiety.Type: GrantFiled: July 20, 2020Date of Patent: May 16, 2023Assignee: CASE WESTERN RESERVE UNIVERSITYInventors: Anirban Sen Gupta, Madhumitha Ravikumar, Christa Modery
-
Patent number: 11623002Abstract: The invention features immunogenic compositions containing anaplastic lymphoma kinase (ALK) polypeptides and methods of use thereof. The immunogenic compositions and methods of the invention may be used to treat a disease associated with ALK in a subject, such as cancer (e.g., a solid tumor cancer or an ALK+ cancer).Type: GrantFiled: January 27, 2017Date of Patent: April 11, 2023Assignee: Elicio Therapeutics, Inc.Inventors: Adrienne Li, Jackson Eby, Peter C. Demuth
-
Patent number: 11607443Abstract: Compositions containing micropeptides capable of modulating the accumulation of miRs involved in certain pathologies, and the use of these micropeptides for treating the certain pathologies. Also, methods of identifying these micropeptides modulating the accumulation of miRs involved in pathologies. Further, nuclei acids encoding those micropeptides that modulate the accumulation of miRs involved in pathologies.Type: GrantFiled: December 22, 2017Date of Patent: March 21, 2023Assignees: UNIVERSITE TOULOUSE III-PAUL SABATIER, CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE, INSERM (INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE), ETABLISSEMENT FRANçAIS DU SANGInventors: Jean-Philippe Combier, Anne Prel, Frédéric Deschaseaux
-
Patent number: 11602555Abstract: The application is directed to a method of inhibiting or reducing growth of clinical isolate bacteria comprising contacting the clinical isolate with a composition comprising glutathione, a glutathione derivative, a glutathione conjugate, a pharmaceutically-acceptable salt thereof, or any combination thereof.Type: GrantFiled: November 17, 2017Date of Patent: March 14, 2023Assignee: RENOVION, INC.Inventors: Dan Copeland, Carolyn Durham, Thomas E. Richardson
-
Patent number: 11596589Abstract: Peptides are provided herein, wherein the peptide bearing one or more amino acid sequence differences relative to SEQ ID NO: 1, with the amino acid sequence differences comprising at least one cysteine replacement.Type: GrantFiled: December 18, 2021Date of Patent: March 7, 2023Assignee: Purvala Bioscience, Inc.Inventor: Justin Paloni
-
Patent number: 11596620Abstract: The invention provides formulations comprising a protein in combination with a compound that prevents oxidation of the protein. The invention also provides methods for making such formulations and methods of using such formulations. The invention further provides methods of screening for compounds that prevent oxidation of a protein in a protein composition and methods of preventing oxidation of a protein in a formulation.Type: GrantFiled: November 22, 2017Date of Patent: March 7, 2023Assignee: F. HOFFMANN-LA ROCHE AGInventors: Sreedhara Alavattam, Mary Mallaney, Parbir Grewal
-
Patent number: 11591365Abstract: Disclosed here are polypeptides derived from the HD2 domain of human B-cell CLL/lymphoma 9 (BCL9) protein and variants thereof, as well as their use in the diagnosis, prevention, and/or treatment of a disease or disorder. Also disclosed are methods of generating such polypeptides and variants thereof.Type: GrantFiled: November 9, 2018Date of Patent: February 28, 2023Assignee: WntRx Pharmaceuticals Inc.Inventors: David Zhu, Robert Perni, Yvonne Angell
-
Patent number: 11584779Abstract: The present disclosure relates to solid state forms of Voclosporin processes for preparation thereof, pharmaceutical compositions thereof and uses thereof for treating lupus nephritis.Type: GrantFiled: October 21, 2019Date of Patent: February 21, 2023Inventors: Pavel Kolesa, Ladislav Cvak, Alexandr Jegorov, Katerina Ondruszova
-
Patent number: 11572394Abstract: A composition for targeting low-density lipoprotein receptor-related protein 6 (LRP6)-overexpressed cells. The composition includes a peptide including at least one of SEQ ID NO: 1 and SEQ ID NO: 3.Type: GrantFiled: February 15, 2021Date of Patent: February 7, 2023Assignees: PASTEUR INSTITUTE OF IRAN, ELHAM RISMANI, LADAN TEIMOORITOOLABIInventors: Elham Rismani, Ladan TeimooriToolabi, Morteza Karimipoor, Seyed Shahriar Arab
-
Patent number: 11566049Abstract: The present disclosure is directed to a peptide of formula (I), or a pharmaceutically acceptable salt thereof, and uses thereof: R1—C—R—X1—X2—P—X3—X4—X5—X6—C—R2 (I) wherein X1, X3, X5, and X6 is an amino acid residue selected from the group consisting of serine, alanine, valine, leucine, isoleucine and glycine; X2 is alanine, arginine or lysine; X4 is glutamic acid or aspartic acid; R1 is selected from the group consisting of S, HS, GHS, PGHS, APGHS, EAPGHS, SEAPGHS, SSEAPGHS, PSSEAPGHS, DPSSEAPGHS and IDPSSEAPGHS, or R1 is absent; and R2 is selected from the group consisting of S, SS, SSK, SSKF, SSKFS, SSKFSW, SSKFSWD, SSKFSWDE, SSKFSWDEY, SSKFSWDEYE, SSKFSWDEYEQ, SSKFSWDEYEQY, SSKFSWDEYEQYK, SSKFSWDEYEQYKK, SSKFSWDEYEQYKKE, or R2 is absent; and wherein the peptide of formula (I), or the pharmaceutically acceptable salt thereof, is a cyclic peptide formed by a disulphide bond between the two cysteine residues.Type: GrantFiled: March 29, 2019Date of Patent: January 31, 2023Assignee: LATERAL IP PTY LTDInventor: Andrew Gearing
-
Patent number: 11565025Abstract: Described herein are compositions comprising a BMP-2 derived peptide conjugated to albumin for use in bone grafts. The composition may further include bone matrix, such as demineralized bone matrix (DBM).Type: GrantFiled: August 25, 2017Date of Patent: January 31, 2023Assignee: PROGENICA THERAPEUTICS, LLCInventors: Abdulhafez Abdulwahed Abdulhafez, Helen Newman, Lawrence Shimp
-
Patent number: 11559231Abstract: A method and system is provided for determining a discrimination index in a subject that may be suffering from or at risk for a stress-induced psychiatric disorder. The discrimination index may be equal to a ratio of a subject's cued fear response and non-cued fear response measured during a fear-potentiated startle (FPS) paradigm. Such a value may allow a physician or researcher to quantify how well a subject discriminates between signaled (cued) fear and un-signaled (non-cued) fear, which may be a biomarker for psychiatric disorders like post-traumatic stress disorder, panic disorder, phobias, and/or generalized anxiety disorder. The determined discrimination index may provide a standardized way of diagnosing and evaluating mental illnesses, more uniform treatment of patients, and/or more precise monitoring and evaluation of treatment efficacy.Type: GrantFiled: May 17, 2019Date of Patent: January 24, 2023Assignee: Rosalind Franklin University of Medicine and ScienceInventor: Joanna Dabrowska