Patents by Inventor Abdel-Majid Khatib

Abdel-Majid Khatib has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20220047556
    Abstract: The proprotein convertases (PCs) are implicated in the activation of various precursor proteins that play a crucial role in various cancers. Using structure-based virtual screening and a compound collection containing FDA approved drugs; the inventors identified Sulconazole as a small molecule able to repress furin activity. Moreover, the inventor show that Sulconazole is particularly suitable for repressing the expression of immune checkpoint protein (e.g. PD-1). 10 Therefore, Sulconazole would be particularly suitable for the treatment of disease involving furin activity in particular for the treatment of cancers.
    Type: Application
    Filed: December 16, 2019
    Publication date: February 17, 2022
    Inventors: Abdel-Majid KHATIB, Maria Mercedes TOME MONTESINOS, Fabienne SOULET, Serge EVRARD, Géraldine SIEGFRIED, Bruno VILLOUTREIX
  • Patent number: 11052131
    Abstract: Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.
    Type: Grant
    Filed: October 4, 2017
    Date of Patent: July 6, 2021
    Assignees: INSERM (INSTITUT NATIONAL DE LA SANTÉ ET DE LA RECHERCHE MÉDICALE), UNIVERSITE DE BORDEAUX, INSTITUT BERGONIÉ
    Inventors: Géraldine Siegfried, Abdel-Majid Khatib, Jean-Luc Hoepffner, Serge Evrard
  • Publication number: 20200030413
    Abstract: Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.
    Type: Application
    Filed: October 4, 2017
    Publication date: January 30, 2020
    Inventors: Géraldine SIEGFRIED, Abdel-Majid KHATIB, Jean-Luc HOEPFFNER, Serge EVRARD
  • Publication number: 20170114113
    Abstract: The present invention relates to polypeptides and their uses as apelin inhibitors. More particularly, the present invention relates to a polypeptide comprising the sequence as set forth in SEQ ID NO:1 wherein at least one arginine residue at position 18, 19, 22 or 23 has been substituted or deleted.
    Type: Application
    Filed: December 28, 2016
    Publication date: April 27, 2017
    Inventors: Geraldine SIEGFRIED, Abdel-Majid KHATIB
  • Patent number: 9593153
    Abstract: The present invention relates to polypeptides and their uses as apelin inhibitors. More particularly, the present invention relates to a polypeptide comprising the sequence as set forth in SEQ ID NO:1 wherein at least one arginine residue at position 18, 19, 22 or 23 has been substituted or deleted.
    Type: Grant
    Filed: April 9, 2013
    Date of Patent: March 14, 2017
    Assignees: INSERM (INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE), UNIVERSITE PARIS-SUD XI, UNIVERSITE DE BORDEAUX
    Inventors: Geraldine Siegfried, Abdel-Majid Khatib
  • Publication number: 20150072932
    Abstract: The present invention relates to polypeptides and their uses as apelin inhibitors. More particularly, the present invention relates to a polypeptide comprising the sequence as set forth in SEQ ID NO:1 wherein at least one arginine residue at position 18, 19, 22 or 23 has been substituted or deleted.
    Type: Application
    Filed: April 9, 2013
    Publication date: March 12, 2015
    Inventors: Geraldine Siegfried, Abdel-Majid Khatib
  • Publication number: 20130149295
    Abstract: The present invention relates to the prevention or therapy of inflammatory diseases. More particularly, the invention relates to an isolated polypeptide comprising the subtilisin-like catalytic domain of the furin or a biologically active derivative thereof, for use in the prevention or treatment of an inflammatory disease.
    Type: Application
    Filed: May 12, 2011
    Publication date: June 13, 2013
    Inventors: Martine Cohen-Solal, Abdel-Majid Khatib