Patents by Inventor Alan A. Aderem

Alan A. Aderem has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 10030053
    Abstract: Embodiments of the disclosure encompass compositions and methods for generating immune responses in an animal or human host. Embodiments of the compositions encompass proteins derived from the surface proteins of bacteria and protozoa, and in particular the flagellum component flagellin, and which have adjunctival properties when administered in conjunction with an immunogen. Embodiments of the compositions of the disclosure are modified to incorporate a heterologous transmembrane-cytoplasmic domain allowing the peptides to be incorporated into virus-like particles. Embodiments of the methods of generating an immunological response in an animal or human comprise exposing the immune system of an animal or human host to an immunogen and a virus-like particle comprising an adjuvant polypeptide including a host cell Toll-like receptor ligand polypeptide having a transmembrane-cytoplasmic tail polypeptide, and a heterologous signal peptide.
    Type: Grant
    Filed: February 13, 2015
    Date of Patent: July 24, 2018
    Assignees: Emory University, Institute for Systems Biology
    Inventors: Richard L. Compans, Baozhong Wang, Jadranmka Boza, Ioanna Skountzou, Alan A. Aderem
  • Patent number: 9085616
    Abstract: The invention provides methods to elicit an immune response with an immunomodulatory flagellin polypeptide having toll-like receptor 5 (TLR5) binding, and further comprising an ADCC targeting molecule.
    Type: Grant
    Filed: July 26, 2011
    Date of Patent: July 21, 2015
    Assignees: THE UNIVERSITY FOR SYSTEMS BIOLOGY, UNIVERSITY OF WASHINGTON
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Publication number: 20150183837
    Abstract: Embodiments of the disclosure encompass compositions and methods for generating immune responses in an animal or human host. Embodiments of the compositions encompass proteins derived from the surface proteins of bacteria and protozoa, and in particular the flagellum component flagellin, and which have adjunctival properties when administered in conjunction with an immunogen. Embodiments of the compositions of the disclosure are modified to incorporate a heterologous transmembrane-cytoplasmic domain allowing the peptides to be incorporated into virus-like particles. Embodiments of the methods of generating an immunological response in an animal or human comprise exposing the immune system of an animal or human host to an immunogen and a virus-like particle comprising an adjuvant polypeptide including a host cell Toll-like receptor ligand polypeptide having a transmembrane-cytoplasmic tail polypeptide, and a heterologous signal peptide.
    Type: Application
    Filed: February 13, 2015
    Publication date: July 2, 2015
    Inventors: Richard L. Compans, Baozhong Wang, Jadranmka Boza, Ioanna Skountzou, Alan A. Aderem
  • Publication number: 20140341908
    Abstract: The invention is directed to an improved method to manufacture virus for use in vaccine by culturing infected cells that have been modified to overexpress miR-144. The invention is also directed to manipulating the activity or level of miR-144 in subjects in order to modulate the antiviral and immune response systems.
    Type: Application
    Filed: May 20, 2014
    Publication date: November 20, 2014
    Applicant: INSTITUTE FOR SYSTEMS BIOLOGY
    Inventors: Carrie M. ROSENBERGER, Alan ADEREM
  • Patent number: 8747860
    Abstract: The invention is directed to an improved method to manufacture virus for use in vaccine by culturing infected cells that have been modified to overexpress miR-144. The invention is also directed to manipulating the activity or level of miR-144 in subjects in order to modulate the antiviral and immune response systems.
    Type: Grant
    Filed: July 5, 2012
    Date of Patent: June 10, 2014
    Assignee: Institute for Systems Biology
    Inventors: Carrie M. Rosenberger, Alan A. Aderem
  • Patent number: 8703146
    Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.
    Type: Grant
    Filed: November 16, 2004
    Date of Patent: April 22, 2014
    Assignee: Institute for Systems Biology
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Publication number: 20130022602
    Abstract: The invention is directed to an improved method to manufacture virus for use in vaccine by culturing infected cells that have been modified to overexpress miR-144. The invention is also directed to manipulating the activity or level of miR-144 in subjects in order to modulate the antiviral and immune response systems.
    Type: Application
    Filed: July 5, 2012
    Publication date: January 24, 2013
    Inventors: Carrie M. Rosenberger, Alan A. Aderem
  • Publication number: 20120269855
    Abstract: The invention provides methods to elicit an immune response with an immunomodulatory flagellin polypeptide having toll-like receptor 5 (TLR5) binding, and further comprising an ADCC targeting molecule.
    Type: Application
    Filed: July 26, 2011
    Publication date: October 25, 2012
    Applicants: University of Washington, The Institute For Systems Biology
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Patent number: 8124015
    Abstract: Microfluidic systems are disclosed, including microfluidic devices and methods, useful for simultaneously analyzing multiple analytes in each of a plurality of distinct nanoliter-volume samples.
    Type: Grant
    Filed: February 3, 2006
    Date of Patent: February 28, 2012
    Assignee: Institute for Systems Biology
    Inventors: Alan Diercks, Adrian Ozinsky, Carl Hansen, Alan Aderem
  • Patent number: 7915381
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT (SEQ ID NO:2), or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Grant
    Filed: April 17, 2002
    Date of Patent: March 29, 2011
    Assignees: Institute for Systems Biology, University of Washington
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Publication number: 20110008318
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Application
    Filed: August 24, 2009
    Publication date: January 13, 2011
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Publication number: 20100322957
    Abstract: Introduction of immunomodulatory T3SS polypeptides (IT3SSP's) into cells stimulates a response mediated by NLRC4 intracellularly. Introduction of said IT3SSP into the cells of a subject evoke an innate immune response in the subject.
    Type: Application
    Filed: May 21, 2010
    Publication date: December 23, 2010
    Inventors: Alan A. Aderem, Edward A. Miao
  • Publication number: 20090297552
    Abstract: Vaccines that comprise or generate immunomodulatory flagellin polypeptides able to stimulate an innate immune response intracellularly and extracellularly employ viruses, bacteria or parasitic cells that contain expression systems for such polypeptides, as well as fusion proteins that contain antigens and/or cell penetrating peptides along with the immunomodulatory peptide.
    Type: Application
    Filed: April 24, 2009
    Publication date: December 3, 2009
    Inventors: Alan A. Aderem, Edward A. Miao, Carrie M. Rosenberger
  • Publication number: 20070183934
    Abstract: Microfluidic systems are disclosed, including microfluidic devices and methods, useful for simultaneously analyzing multiple analytes in each of a plurality of distinct nanoliter-volume samples.
    Type: Application
    Filed: February 3, 2006
    Publication date: August 9, 2007
    Applicant: Institute for Systems Biology
    Inventors: Alan Diercks, Adrian Ozinsky, Carl Hansen, Alan Aderem
  • Publication number: 20050147627
    Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.
    Type: Application
    Filed: November 16, 2004
    Publication date: July 7, 2005
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly Smith, David Underhill, Adrian Ozinsky
  • Publication number: 20030044429
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Application
    Filed: April 17, 2002
    Publication date: March 6, 2003
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Publication number: 20030026780
    Abstract: The invention provides a composition containing two or more ADCC targeting molecules, each selective for different antigens on the surface of a target cell, and in a pharmaceutically acceptable medium. The composition can contain more than two binding species. The composition also can be a pentameric binding molecule. Also provided is a composition containing effector cells and two or more ADCC targeting molecule species in a pharmaceutically acceptable medium. The invention further provides a method of inducing antibody-dependent cell cytotoxicity (ADCC) against a target cell. The method consists of contacting the target cell in the presence of effector cells with two or more ADCC targeting molecule species each selective for different antigens on the surface of the target cell. A method of treating a pathological condition characterized by aberrant cell growth is also provided.
    Type: Application
    Filed: July 18, 2001
    Publication date: February 6, 2003
    Inventors: Leroy E. Hood, Alan Aderem
  • Patent number: 5885772
    Abstract: The invention includes methods and materials, including probes, to be used as diagnostic tools for detecting anencephaly. Such methods may be practiced by both manual and automated means, and in the instance of the latter, suitable equipment for such automated performance is also contemplated. Also included within the invention are mouse embryos null for a gene encoding a protein kinase C substrate which binds calcium-calmodulin and regulates cell movement and membrane traffic, and cells derived from such embryos.
    Type: Grant
    Filed: March 16, 1995
    Date of Patent: March 23, 1999
    Assignee: The Rockefeller University
    Inventors: Alan A. Aderem, Jianmin Chen, Sandy Chang