Patents by Inventor Alice Christina Cavanagh

Alice Christina Cavanagh has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20120082690
    Abstract: The invention is directed to the use of cpn10 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.
    Type: Application
    Filed: November 7, 2011
    Publication date: April 5, 2012
    Inventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
  • Patent number: 8067361
    Abstract: The invention is directed to the use of cpn10 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.
    Type: Grant
    Filed: October 1, 2009
    Date of Patent: November 29, 2011
    Assignee: CBIO Limited
    Inventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
  • Publication number: 20100099605
    Abstract: The invention is directed to the use of cpn10 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.
    Type: Application
    Filed: October 1, 2009
    Publication date: April 22, 2010
    Inventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
  • Patent number: 7618935
    Abstract: The invention is directed to the use of cpnl0 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.
    Type: Grant
    Filed: November 6, 2003
    Date of Patent: November 17, 2009
    Assignee: CBIO Limited
    Inventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
  • Patent number: 7358329
    Abstract: Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSMAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDIL GKYVD (SEQ ID NO:21). Antibodies are raised against either the entire sequence of cpn 10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKFLPL (SEQ ID NO:2), ACQAFRKFLPL (SEQ ID NO 1), or EKSQGKVLQAT (SEQ ID NO:3), in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.
    Type: Grant
    Filed: May 21, 2002
    Date of Patent: April 15, 2008
    Assignee: The University of Queensland
    Inventors: Halle Morton, Alice Christina Cavanagh
  • Publication number: 20030175280
    Abstract: Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGK YVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPL, AGQAFRKFLPL, or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.
    Type: Application
    Filed: May 21, 2002
    Publication date: September 18, 2003
    Applicant: The University of Queensland
    Inventors: Halle Morton, Alice Christina Cavanagh
  • Patent number: 6417334
    Abstract: Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPI.,AGQAFRKFI.PI., or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.
    Type: Grant
    Filed: February 23, 1999
    Date of Patent: July 9, 2002
    Assignee: The University of Queensland
    Inventors: Halle Morton, Alice Christina Cavanagh
  • Patent number: 6117421
    Abstract: A process for the detection of cpn10 in serum or other biological fluids including the steps of (i) raising antibody to cpn10; (ii) reacting said antibody with a sample of biological fluid suspected of containing cpn10; and (iii) detecting the presence of cpn10 in said sample by a signal amplification resulting from production of a cpn10-antibody complex. There is also provided a process for promotion of cell growth or immunosuppression including the step of administration of cpn10 to a mammalian subject. There is also provided recombinant cpn10.
    Type: Grant
    Filed: May 29, 1996
    Date of Patent: September 12, 2000
    Assignee: The University of Queensland
    Inventors: Halle Morton, Alice Christina Cavanagh
  • Patent number: 6113899
    Abstract: An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antagonist or Ab raised against a peptide derived from cpn10, or a peptide with the sequence: Ac-AGQAFRKLPL(C) AGQAFRKFLPLA2 A1AGQAFRKFLPL Ac-A1AGQAFRKFLPL (A1)EKSQGKVLQATA2 A1EKSQGKVLQAT where A1 and A2 are amino acid sequences that may be added to one or both ends of the peptides, and where the peptides may have a single amino acid deletion, addition or substitution; (2) suppressing cellular growth or enhancing immunological activity by admin. of a cpn10 antagonist or anti-cpn10 Ab to a subject; and (3) an assay for measuring anti-cpn10 Ab in a sample by: (a) reacting purified cpn10 with the sample (b) determining the amt. of Ab in the sample by determining the binding between the Ab and cpn10.
    Type: Grant
    Filed: May 29, 1996
    Date of Patent: September 5, 2000
    Assignee: The University of Queensland
    Inventors: Halle Morton, Alice Christina Cavanagh