Patents by Inventor Claudia Juno
Claudia Juno has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 11980657Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: GrantFiled: January 11, 2021Date of Patent: May 14, 2024Assignee: AFFIRIS CVD GMBHInventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
-
Publication number: 20210138048Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: ApplicationFiled: January 11, 2021Publication date: May 13, 2021Applicant: AFFIRIS AGInventors: Sylvia BRUNNER, Gergana GALABOVA, Gabriele WINSAUER, Erika BILCIKOVA, Claudia JUNO, Pola LINZMAYER-HIRT, Birgit SCHUH, Guenther STAFFLER
-
Patent number: 10933123Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: GrantFiled: May 21, 2018Date of Patent: March 2, 2021Assignee: AFFIRIS AGInventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
-
Publication number: 20180289781Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: ApplicationFiled: May 21, 2018Publication date: October 11, 2018Applicant: AFFIRIS AGInventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
-
Patent number: 10004791Abstract: The present invention relates to a vaccine capable to induce production of antibodies directed to PCSK9 in vivo.Type: GrantFiled: February 23, 2015Date of Patent: June 26, 2018Assignee: AFFIRIS AGInventors: Gergana Galabova, Guenther Staffler, Sylvia Brunner, Gabriele Winsauer, Andreas Mairhofer, Claudia Juno
-
Patent number: 9999659Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: GrantFiled: December 2, 2016Date of Patent: June 19, 2018Assignee: AFFIRIS AGInventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
-
Patent number: 9669079Abstract: The present invention relates to a immunogen comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID NO:9).Type: GrantFiled: October 23, 2015Date of Patent: June 6, 2017Assignee: AFFIRIS AGInventors: Sylvia Brunner, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
-
Publication number: 20170112908Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: ApplicationFiled: December 2, 2016Publication date: April 27, 2017Applicant: AFFIRIS ABInventors: Sylvia BRUNNER, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
-
Publication number: 20170065689Abstract: The present invention relates to a vaccine capable to induce production of antibodies directed to PCSK9 in vivo.Type: ApplicationFiled: February 23, 2015Publication date: March 9, 2017Applicant: AFFIRIS AGInventors: Gergana GALABOVA, Guenther STAFFLER, Sylvia BRUNNER, Gabriele WINSAUER, Andreas MAIRHOFER, Claudia Juno
-
Patent number: 9533030Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: GrantFiled: August 28, 2013Date of Patent: January 3, 2017Assignee: AFFIRIS AGInventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
-
Publication number: 20160106822Abstract: The present invention relates to a immunogen comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID NO:9).Type: ApplicationFiled: October 23, 2015Publication date: April 21, 2016Applicant: Affiris AGInventors: Sylvia BRUNNER, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
-
Patent number: 9220762Abstract: A vaccine or immunogenic composition comprising at least two fragments of proprotein convertase subtilisin/kexin type 9 (PCSK9) where one fragment contains at least 9 consecutive residues of residues 153 to 165 of PCSK9 and the other fragment contains at least 9 consecutive residues 209 to 222 of the PCSK9 (SEQ ID NO:9). Methods of treatment for hyperlipidemia, hypercholesterolemia, and atherosclerosis involving administering this vaccine.Type: GrantFiled: September 13, 2012Date of Patent: December 29, 2015Assignee: AFFIRIS AGInventors: Sylvia Brunner, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
-
Publication number: 20150306191Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.Type: ApplicationFiled: August 28, 2013Publication date: October 29, 2015Applicant: AFFIRIS AGInventors: Sylvia BRUNNER, Gergana GALABOVA, Gabriele WINSAUER, Erika BILCIKOVA, Claudia JUNO, Pola LINZMAYER-HIRT, Birgit SCHUH, Guenther STAFFLER
-
Patent number: 9085636Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.Type: GrantFiled: June 11, 2012Date of Patent: July 21, 2015Assignee: AFFIRIS AGInventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh
-
Publication number: 20150071951Abstract: The present invention relates to a vaccine comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein said at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID No. 9).Type: ApplicationFiled: September 13, 2012Publication date: March 12, 2015Applicant: AFFIRIS AGInventors: Sylvia Brunner, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
-
Publication number: 20140147456Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.Type: ApplicationFiled: June 11, 2012Publication date: May 29, 2014Applicant: AFFIRIS AGInventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh