Patents by Inventor Claudia Juno

Claudia Juno has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 11980657
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: January 11, 2021
    Date of Patent: May 14, 2024
    Assignee: AFFIRIS CVD GMBH
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20210138048
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: January 11, 2021
    Publication date: May 13, 2021
    Applicant: AFFIRIS AG
    Inventors: Sylvia BRUNNER, Gergana GALABOVA, Gabriele WINSAUER, Erika BILCIKOVA, Claudia JUNO, Pola LINZMAYER-HIRT, Birgit SCHUH, Guenther STAFFLER
  • Patent number: 10933123
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: May 21, 2018
    Date of Patent: March 2, 2021
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20180289781
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: May 21, 2018
    Publication date: October 11, 2018
    Applicant: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Patent number: 10004791
    Abstract: The present invention relates to a vaccine capable to induce production of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: February 23, 2015
    Date of Patent: June 26, 2018
    Assignee: AFFIRIS AG
    Inventors: Gergana Galabova, Guenther Staffler, Sylvia Brunner, Gabriele Winsauer, Andreas Mairhofer, Claudia Juno
  • Patent number: 9999659
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: December 2, 2016
    Date of Patent: June 19, 2018
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Patent number: 9669079
    Abstract: The present invention relates to a immunogen comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID NO:9).
    Type: Grant
    Filed: October 23, 2015
    Date of Patent: June 6, 2017
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
  • Publication number: 20170112908
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: December 2, 2016
    Publication date: April 27, 2017
    Applicant: AFFIRIS AB
    Inventors: Sylvia BRUNNER, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20170065689
    Abstract: The present invention relates to a vaccine capable to induce production of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: February 23, 2015
    Publication date: March 9, 2017
    Applicant: AFFIRIS AG
    Inventors: Gergana GALABOVA, Guenther STAFFLER, Sylvia BRUNNER, Gabriele WINSAUER, Andreas MAIRHOFER, Claudia Juno
  • Patent number: 9533030
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: August 28, 2013
    Date of Patent: January 3, 2017
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20160106822
    Abstract: The present invention relates to a immunogen comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID NO:9).
    Type: Application
    Filed: October 23, 2015
    Publication date: April 21, 2016
    Applicant: Affiris AG
    Inventors: Sylvia BRUNNER, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
  • Patent number: 9220762
    Abstract: A vaccine or immunogenic composition comprising at least two fragments of proprotein convertase subtilisin/kexin type 9 (PCSK9) where one fragment contains at least 9 consecutive residues of residues 153 to 165 of PCSK9 and the other fragment contains at least 9 consecutive residues 209 to 222 of the PCSK9 (SEQ ID NO:9). Methods of treatment for hyperlipidemia, hypercholesterolemia, and atherosclerosis involving administering this vaccine.
    Type: Grant
    Filed: September 13, 2012
    Date of Patent: December 29, 2015
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
  • Publication number: 20150306191
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: August 28, 2013
    Publication date: October 29, 2015
    Applicant: AFFIRIS AG
    Inventors: Sylvia BRUNNER, Gergana GALABOVA, Gabriele WINSAUER, Erika BILCIKOVA, Claudia JUNO, Pola LINZMAYER-HIRT, Birgit SCHUH, Guenther STAFFLER
  • Patent number: 9085636
    Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.
    Type: Grant
    Filed: June 11, 2012
    Date of Patent: July 21, 2015
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh
  • Publication number: 20150071951
    Abstract: The present invention relates to a vaccine comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein said at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID No. 9).
    Type: Application
    Filed: September 13, 2012
    Publication date: March 12, 2015
    Applicant: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Bettina Wanko, Markus Windwarder, Gabriele Winsauer, Guenther Staffler, Claudia Juno
  • Publication number: 20140147456
    Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.
    Type: Application
    Filed: June 11, 2012
    Publication date: May 29, 2014
    Applicant: AFFIRIS AG
    Inventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh