Patents by Inventor Halle Morton
Halle Morton has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Publication number: 20120082690Abstract: The invention is directed to the use of cpn10 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.Type: ApplicationFiled: November 7, 2011Publication date: April 5, 2012Inventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
-
Patent number: 8067361Abstract: The invention is directed to the use of cpn10 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.Type: GrantFiled: October 1, 2009Date of Patent: November 29, 2011Assignee: CBIO LimitedInventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
-
Publication number: 20100099605Abstract: The invention is directed to the use of cpn10 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.Type: ApplicationFiled: October 1, 2009Publication date: April 22, 2010Inventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
-
Patent number: 7618935Abstract: The invention is directed to the use of cpnl0 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.Type: GrantFiled: November 6, 2003Date of Patent: November 17, 2009Assignee: CBIO LimitedInventors: Geoffrey R. Hill, Tatjana Banovic, Halle Morton, Alice Christina Cavanagh
-
Publication number: 20090214473Abstract: A method of treating multiple sclerosis (MS) is provided which includes the step of administering a pharmaceutically-effective amount of chaperonin 10 and IFN-beta. Also provided are pharmaceutical compositions and a kit for treating MS, which include chaperonin 10 and IFN-beta.Type: ApplicationFiled: January 29, 2009Publication date: August 27, 2009Applicant: The University of Queensland of St. LuciaInventors: Halle MORTON, Alice CAVANAGH
-
Patent number: 7358329Abstract: Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSMAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDIL GKYVD (SEQ ID NO:21). Antibodies are raised against either the entire sequence of cpn 10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKFLPL (SEQ ID NO:2), ACQAFRKFLPL (SEQ ID NO 1), or EKSQGKVLQAT (SEQ ID NO:3), in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.Type: GrantFiled: May 21, 2002Date of Patent: April 15, 2008Assignee: The University of QueenslandInventors: Halle Morton, Alice Christina Cavanagh
-
Publication number: 20030175280Abstract: Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGK YVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPL, AGQAFRKFLPL, or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.Type: ApplicationFiled: May 21, 2002Publication date: September 18, 2003Applicant: The University of QueenslandInventors: Halle Morton, Alice Christina Cavanagh
-
Patent number: 6417334Abstract: Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPI.,AGQAFRKFI.PI., or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.Type: GrantFiled: February 23, 1999Date of Patent: July 9, 2002Assignee: The University of QueenslandInventors: Halle Morton, Alice Christina Cavanagh
-
Patent number: 6117421Abstract: A process for the detection of cpn10 in serum or other biological fluids including the steps of (i) raising antibody to cpn10; (ii) reacting said antibody with a sample of biological fluid suspected of containing cpn10; and (iii) detecting the presence of cpn10 in said sample by a signal amplification resulting from production of a cpn10-antibody complex. There is also provided a process for promotion of cell growth or immunosuppression including the step of administration of cpn10 to a mammalian subject. There is also provided recombinant cpn10.Type: GrantFiled: May 29, 1996Date of Patent: September 12, 2000Assignee: The University of QueenslandInventors: Halle Morton, Alice Christina Cavanagh
-
Patent number: 6113899Abstract: An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antagonist or Ab raised against a peptide derived from cpn10, or a peptide with the sequence: Ac-AGQAFRKLPL(C) AGQAFRKFLPLA2 A1AGQAFRKFLPL Ac-A1AGQAFRKFLPL (A1)EKSQGKVLQATA2 A1EKSQGKVLQAT where A1 and A2 are amino acid sequences that may be added to one or both ends of the peptides, and where the peptides may have a single amino acid deletion, addition or substitution; (2) suppressing cellular growth or enhancing immunological activity by admin. of a cpn10 antagonist or anti-cpn10 Ab to a subject; and (3) an assay for measuring anti-cpn10 Ab in a sample by: (a) reacting purified cpn10 with the sample (b) determining the amt. of Ab in the sample by determining the binding between the Ab and cpn10.Type: GrantFiled: May 29, 1996Date of Patent: September 5, 2000Assignee: The University of QueenslandInventors: Halle Morton, Alice Christina Cavanagh