Abstract: The present invention provides polypeptides having a length of up to 180 amino acids and containing a sequence selected from sequences identical or differing at most in 5 amino acids from the sequence: KSELAVEILEKGQVRFWMQAX21X22X23X24GNAKVNYIFNEKEIFEGPKYKMHIDXsoXsiXszGIIEM FMEKLQDEDEGTYTFQLQX76X77X78X79X80NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG (SEQ ID NO. 2), wherein X21X22X23X24 is selected from KAQQ (SEQ ID NO. 33), LSVF (SEQ ID NO. 34), ATPS (SEQ ID NO. 35), EIMW (SEQ ID NO. 36), DGSS (SEQ ID NO. 37), LLPL (SEQ ID NO. 38), WMWW (SEQ ID NO. 39), MNLY (SEQ ID NO. 40), MWRN (SEQ ID NO. 41), IMME (SEQ ID NO. 42), KHQL (SEQ ID NO. 43), HWQF (SEQ ID NO. 44), YAGN (SEQ ID NO. 45) and HGQW (SEQ ID NO. 46); X50X51X52 is selected from RNT, IMF, GHE, PSW, RAN, YFW, ITL, QAM, DMR, WLW, QGE, VQY and VSL; X76X77X78X79X80 is selected from SHHLG (SEQ ID NO. 47), FMLMM (SEQ ID NO. 48), VILIL (SEQ ID NO. 49), IVTPL (SEQ ID NO. 50), DFIIW (SEQ ID NO. 51), MWSE (deletion) (SEQ ID NO. 52), LYYAW (SEQ ID NO. 53), MMIEY (SEQ ID NO.

Abstract: An apparatus for auto addressing includes a communication bus interface configured to receive an address assignment request to assign an address to the apparatus. A functional connection is configured to activate a device connected to the apparatus. A detector is configured to measure a characteristic of the device and to compare the characteristic with a validation parameter. The characteristic depends on the functional connection. An address assignment circuit is configured to store the address in a memory of the apparatus in response to receiving the address assignment request at the apparatus, and the characteristic being validated with the validation parameter.

Abstract: An apparatus for auto addressing includes a communication bus interface configured to receive an address assignment request to assign an address to the apparatus. A functional connection is configured to activate a device connected to the apparatus. A detector is configured to measure a characteristic of the device and to compare the characteristic with a validation parameter. The characteristic depends on the functional connection. An address assignment circuit is configured to store the address in a memory of the apparatus in response to receiving the address assignment request at the apparatus, and the characteristic being validated with the validation parameter.