Abstract: A method for evaluating a user's skin condition, the method being performed by a computer, includes acquiring image data concerning part of the user's body and including information for four or more bands, determining an evaluation region in the part of the user's body in an image representing the part of the user's body in accordance with an input from the user, and generating, based on the image data, and outputting evaluation data representing an evaluation result of skin condition in the evaluation region.

Abstract: A method for evaluating an infection risk includes calculating a first infection risk value, which indicates a degree of an infection risk that a child is infected with an infectious disease, on the basis of infection information regarding family members, prevalence information regarding the infectious disease in organizations to which the family members belong, and one or more first infection risk coefficients, calculating, on the basis of the first infection risk value, a second infection risk value, which indicates a degree of the child's infection risk of being infected in a group at a children's facility, and performing first evaluation, in which the infection risk that the child is infected is evaluated on the basis of the first infection risk value, and second evaluation, in which the child's infection risk of being infected in the group is evaluated on the basis of the second infection risk value.

Abstract: The present invention provides an antibody including a structural domain represented by the following amino acid sequence, in an N- to C-direction, N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein the antibody further includes a protein molecule bound to the structural domain; the structural domain is capable of binding to a norovirus; FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; any one of the following requirements (i)-(iii) is satisfied.

Abstract: Provided is a dimer antibody including two structural domains independently each represented by the following amino acid sequence, in an N- to C-direction, N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein the antibody is capable of binding to a norovirus; FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; any one of the following requirements (i)-(iii) is satisfied.

Abstract: A method for evaluating an infection risk includes calculating a first infection risk value, which indicates a degree of an infection risk that a child is infected with an infectious disease, on the basis of infection information regarding family members, prevalence information regarding the infectious disease in organizations to which the family members belong, and one or more first infection risk coefficients, calculating, on the basis of the first infection risk value, a second infection risk value, which indicates a degree of the child's infection risk of being infected in a group at a children's facility, and performing first evaluation, in which the infection risk that the child is infected is evaluated on the basis of the first infection risk value, and second evaluation, in which the child's infection risk of being infected in the group is evaluated on the basis of the second infection risk value.

Abstract: The present invention provides an antibody including a structural domain represented by the following amino acid sequence, in an N- to C-direction, N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein the antibody further includes a protein molecule bound to the structural domain; the structural domain is capable of binding to a norovirus; FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; any one of the following requirements (i)-(iii) is satisfied.

Abstract: Provided is a dimer antibody including two structural domains independently each represented by the following amino acid sequence, in an N- to C-direction, N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein the antibody is capable of binding to a norovirus; FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; any one of the following requirements (i)-(iii) is satisfied.

Abstract: The present invention provides a novel antibody capable of binding to a norovirus. The present invention is an antibody that consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of any one of an amino acid sequences represented by SEQ ID NO: 1-SEQ ID NO: 6; the CDR2 consists of any one of an amino acid sequences represented by SEQ ID NO: 7-SEQ ID NO: 12; the CDR3 consists of any one of an amino acid sequences represented by SEQ ID NO: 13-SEQ ID NO: 17; and the antibody is capable of binding to a norovirus.

Abstract: The present invention provides a novel antibody capable of binding to a norovirus. The present invention is an antibody that consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of any one of an amino acid sequences represented by SEQ ID NO: 1-SEQ ID NO: 6; the CDR2 consists of any one of an amino acid sequences represented by SEQ ID NO: 7-SEQ ID NO: 12; the CDR3 consists of any one of an amino acid sequences represented by SEQ ID NO: 13-SEQ ID NO: 17; and the antibody is capable of binding to a norovirus.

Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Abstract: An immunosensor includes a base body (101) having a sample holding portion (102) which holds a test sample, a sample introducing port (103) which is communicated with the sample holding portion (102) and through which the test sample is introduced to the sample holding portion (102), a dried first reagent body (109) which contains an antibody to a material to be measured which is contained in the test sample, and a dried second reagent body (110) which contains polyethylene glycol, and in the sample holding portion (102), the first reagent body (109) is placed closer to the sample introducing port (103) than the second reagent body (110).

Abstract: The immunoassay method of this invention measures the content of a subject substance in a sample. The method includes the steps of: (a) preparing a mixed solution by mixing the sample and an antibody solution including a first monoclonal antibody and a second monoclonal antibody capable of specifically binding to the subject substance; and (b) measuring an optical property of the mixed solution. The first monoclonal antibody is capable of binding to a first epitope of the subject substance, and the second monoclonal antibody is capable of binding to a second epitope of the subject substance different from the first epitope. Each of the first and second epitopes exists singly in the subject substance.

Abstract: According to the present invention, the expansion of measurable concentration range for an antigen in a sample solution can be achieved, without a step of dilution or the like. The concentration of an antigen contained in a sample solution is determined from the maximum value and/or minimum value of turbidity level detected in the observation of the transient phenomenon of turbidity, elapsed time when the maximum and/or minimum value is observed, and turbidity level.

Abstract: The present invention relates to an immunoreaction measuring method for measuring an antigen or antibody contained as a subject substance in a sample, wherein the sample was mixed with at least one compound selected from the group consisting of dicarboxylic acids having a hydroxyl group, dicarboxylic acids having a double bond, straight-chain dicarboxylic acids expressed by the chemical formula (1): HOOC(CH2)nCOOH (n is an integer), and the salts of these dicarboxylic acids, and an antibody or antigen as a specifically binding substance capable of specifically binding to the subject substance, to obtain an acidic reaction solution, and then an antigen-antibody complex, generated by an antigen-antibody reaction of the subject substance with the specifically binding substance in the reaction solution was detected. This makes it possible to improve a measurement value and to relax a limitation of a measurement range due to a zone phenomenon that occurs in an antigen-excess region.

Abstract: It is intended to provide an antibody specific to HbA1c, antibody-producing cells capable of supplying the antibody in a stable state in the future, and a method of constructing the antibody-producing cells without any probability factors, and a method which comprises fusing mouse spleen cells, which have been sensitized with an immunogen composed of a compound containing the following structural formula (I) and a binding protein, with a myeloma-origin cell line, obtaining monoclonal antibody-producing cells by cloning, and then purifying and acquiring the monoclonal antibody produced by these cells into the culture supernatant

Abstract: The present invention provides a high-performance glucose sensor having excellent storage stability and an improved response characteristic. This sensor comprises: an electrically insulating base plate; an electrode system including at least a working electrode and a counter electrode formed on the base plate; and a reaction layer containing at least pyrrolo-quinoline quinone dependent glucose dehydrogenase, formed in contact with or in the vicinity of the electrode system, and the reaction layer contains at least one kind of additive selected from the group consisting of gluconic acid and salts thereof.

Abstract: The present invention relates to an immunoreaction measuring method for measuring an antigen or antibody contained as a subject substance in a sample, wherein the sample was mixed with at least one compound selected from the group consisting of dicarboxylic acids having a hydroxyl group, dicarboxylic acids having a double bond, straight-chain dicarboxylic acids expressed by the chemical formula (1): HOOC(CH2)nCOOH (n is an integer), and the salts of these dicarboxylic acids, and an antibody or antigen as a specifically binding substance capable of specifically binding to the subject substance, to obtain an acidic reaction solution, and then an antigen-antibody complex, generated by an antigen-antibody reaction of the subject substance with the specifically binding substance in the reaction solution was detected. This makes it possible to improve a measurement value and to relax a limitation of a measurement range due to a zone phenomenon that occurs in an antigen-excess region.

Abstract: According to the present invention, the expansion of measurable concentration range for an antigen in a sample solution can be achieved, without a step of dilution or the like. The concentration of an antigen contained in a sample solution is determined from the maximum value and/or minimum value of turbidity level detected in the observation of the transient phenomenon of turbidity, elapsed time when the maximum and/or minimum value is observed, and turbidity level.

Abstract: As shown in FIG. 1, an immunochromatography test strip 10 of the present embodiment is made of a base material 11 which includes a sample introduction section 12, a labeling section 13 and an immobilization section 14. The base material 11 is made of a material that is capable of being impregnated with a solvent of a sample solution containing a detection target substance. The material allows migration of a solvent of a sample solution by capillary action. The sample introduction section 12 is a region where a sample solution containing a detection target substance is introduced (e.g., dripped). The sample introduction section 12 contains a metal salt supported thereon. The labeling section 13 contains a labeled antibody 15, which is labeled with a labeling substance, in a state such that the labeled antibody 15 can be eluted into the sample solution. The labeled antibody 15 used herein specifically binds to a detection target substance. The immobilization section 14 contains an immobilized antibody 16.