Abstract: Novel dimethyl 7-bromo-1-(4-substituted benzoyl)pyrrolo[1,2-?]quinoline-2,3-dicarboxylates compounds, having the structure: A method of synthesizing said compounds, a pharmaceutical composition comprising said compounds and a suitable carrier, and a method of using the compounds. The dimethyl 7-bromo-1-(4-substituted benzoyl)pyrrolo[1,2-?]quinoline-2,3-dicarboxylates compounds, identified as anti-inflammatory agents, are useful for treating inflammation, pain, and swelling in a patient.

Abstract: Compounds for treating tuberculosis and, particularly, to anti-tubercular compounds that are 1-(2-(substitutedphenyl)-2-oxoethyl)-3,5-dimethylpyridin-1-ium bromides and their use as anti-tubercular agents.

Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Abstract: Methods of treating trypanosomiasis and, particularly, methods of treating trypanosomiasis using neohesperidin dihydrochalcone. Such methods of treatment are useful in, for example, animals selected from the group consisting of cattle, sheep, pigs, goats, horses, and camels.

Abstract: Methods of treating trypanosomiasis and, particularly, to methods of treating trypanosomiasis using raltitrexed. Such methods of treatment are useful in, for example, animals selected from the group consisting of cattle, sheep, pigs, goats, horses, and camels.

Abstract: A method of treating a protozoan infection includes administering an antiprotozoal agent to a patient in need thereof. The antiprotozoal agent is selected from Compound 1 (4-{3-[4-(4-fluorophenyl)-1H-pyrazol-5-yl]piperidin-1-yl}-7H-pyrrolo[2,3-d]pyrimidine) and Compound 2 (6-{3-[4-(4-fluorophenyl)-1H-pyrazol-5-yl]piperidin-1-yl}-9H-purine). Compounds 1 and 2 exhibit broad spectrum trypanocidal activity.

Abstract: A method of inhibiting cyclooxygenase includes administering an inhibitory agent to a patient in need thereof. The inhibitory agent is selected from Compound 1 (5-{[(4-fluorobenzyl)(tetrahydrofuran-2-ylmethyl)amino]methyl}-2-methoxyphenyl)methanol), Compound 2 (N-{[3-(3-methoxyphenyl)-1-phenyl-1H-pyrazol-4-yl]methyl}-N-methyl-2-(1H-pyrazol-4-yl)ethanamine), Compound 3 ({4-[3-(2-pyridinyl)benzyl]-3-morpholinyl}acetic acid), and Compound 4 ([4-chloro-2-(7-oxo-5,6,7,8-tetrahydro-1H-pyrazole[4,3-g]quinoline-5-yl)phenoxy]acetic acid). Compounds 1-4 may inhibit both the COX-1 and the COX-2 enzymes.

Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #1 (SEQ ID NO: 1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO: 2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO: 11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL. The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Abstract: SARS-CoV-2 inhibitors include pharmaceutical compounds capable of binding to the active site of SARS-CoV-2 Mpro. The SARS-CoV-2 inhibitors may be used in pharmaceuticals to prevent and/or treat SARS-CoV-2 infection. The pharmaceuticals may be formulated to comprise at least one SARS-CoV-2 inhibitor and a carrier, or they may include at least one SARS-CoV-2 inhibitor and a further pharmaceutical compound known to be effective against SARS-CoV-2.

Abstract: A method of treating inflammation includes administering an anti-inflammatory agent to a patient in need thereof. The anti-inflammatory agent is selected from Compound 1 ([(2-{[3-(4-methyl-1H-benzimidazol-2-yl)piperidin-1-yl]carbonyl}phenyl) amino] acetic acid) and Compound 2 (Ethyl-1-(5-cyano-2-hydroxyphenyl)-4-oxo-5-phenoxy-1,4-dihydropyridine-3-carboxylate). Compound 1 and Compound 2 selectively inhibit COX-2 enzyme, without substantially inhibiting COX-1 enzyme, in contrast to many other NSAIDs.

Abstract: Anti-SARS-CoV-2 fusion peptides are provided. The anti-SARS-CoV-2 fusion peptides include peptide sequences corresponding to the sequence of the SARS-CoV-2 fusion complex heptad repeat domain HR2 and having at least one artificial mutation. The anti-SARS-CoV-2 fusion peptides may be 39-mers, such as peptides #121 (SEQ ID NO: 2) and #125 (SEQ ID NO: 5). These peptides may competitively bind to SARS-CoV-2 and prevent either membrane mediated SARS-CoV-2 fusion, endocytosis-mediated viral entry, or both. The anti-SARS-CoV-2 fusion peptides may be administered to a subject in need thereof to inhibit or prevent SARS-CoV-2 cellular entry.

Abstract: A method of treating fungal infections using dabigatran etexilate is provided. The method can include administering a therapeutically effective amount of dabigatran etexilate to a subject in need thereof. In an embodiment, dabigatran etexilate may be effective as a broad-spectrum antifungal agent and may be used to treat infections resulting from a wide array of fungal pathogens. In an embodiment, dabigatran etexilate may be administered to treat either a topical or systemic fungal infection.

Abstract: Anti-SARS-CoV-2 fusion peptides are provided. The anti-SARS-CoV-2 fusion peptides include peptide sequences corresponding to the sequence of the SARS-CoV-2 fusion complex heptad repeat domain HR2 and having at least one artificial mutation. The anti-SARS-CoV-2 fusion peptides may be 39-mers, such as peptides #121 (SEQ ID NO: 2) and #125 (SEQ ID NO: 5). These peptides may competitively bind to SARS-CoV-2 and prevent either membrane mediated SARS-CoV-2 fusion, endocytosis-mediated viral entry, or both. The anti-SARS-CoV-2 fusion peptides may be administered to a subject in need thereof to inhibit or prevent SARS-CoV-2 cellular entry.

Abstract: The MERS-CoV inhibitor peptides include a set of peptides designed by modification or mutation of a wild type MERS-CoV fusion protein. The MERS-CoV inhibitor peptides are capable of inhibition of MERS-CoV membrane fusion, and thereby may prevent or slow the spread of MERS-CoV infections. Thus, the MERS-CoV inhibitor peptides may be used in pharmaceuticals to prevent and/or treat MERS-CoV infection. The pharmaceuticals may be formulated to comprise at least one of the MERS-CoV inhibitor peptides and a carrier, or they may include one or more expression systems capable of promoting cellular expression of one or more MERS-CoV inhibitor peptides. The MERS-CoV inhibitor peptides may also be used as reagents for MERS-CoV inhibition assays as a standard or reference inhibitors.

Abstract: The MERS-CoV inhibitor peptides include a set of peptides designed by modification or mutation of a wild type MERS-CoV fusion protein. The MERS-CoV inhibitor peptides are capable of inhibition of MERS-CoV membrane fusion, and thereby may prevent or slow the spread of MERS-CoV infections. Thus, the MERS-CoV inhibitor peptides may be used in pharmaceuticals to prevent and/or treat MERS-CoV infection. The pharmaceuticals may be formulated to comprise at least one of the MERS-CoV inhibitor peptides and a carrier, or they may include one or more expression systems capable of promoting cellular expression of one or more MERS-CoV inhibitor peptides. The MERS-CoV inhibitor peptides may also be used as reagents for MERS-CoV inhibition assays as a standard or reference inhibitors.