Patents by Inventor Ralph Graham Hope

Ralph Graham Hope has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Protein fragments for use in protein targeting
    Patent number: 6670462
    Abstract: A protein is described. The protein comprises a lipid globule targeting sequence linked to a protein of interest (POI) wherein the targeting sequence comprises a hepatitis C virus (HCV) core protein or fragment or homologue thereof.
    Type: Grant
    Filed: October 1, 2001
    Date of Patent: December 30, 2003
    Assignee: Medical Research Council
    Inventors: Ralph Graham Hope, John McLauchlan
  • Protein fragments for use in protein targeting
    Publication number: 20030077755
    Abstract: A protein is described. The protein comprises a lipid globule targeting sequence linked to a protein of interest (POI) wherein the targeting sequence comprises a hepatitis C virus (HCV) core protein or fragment or homologue thereof.
    Type: Application
    Filed: October 1, 2001
    Publication date: April 24, 2003
    Inventors: Ralph Graham Hope, John McLauchlan
  • Viral therapeutics
    Publication number: 20020115066
    Abstract: A method for identifying a substance for affecting a viral infection is described. The method comprises providing a lipid globule targeting sequence, as a first component; providing a lipid globule, as a second component; contacting the two components with a substance to be tested under conditions that would permit the two components to interact in the absence of the substance; and determining whether the substance disrupts the interaction between the first and second components; where the targeting sequence comprises a hepatitis C virus (HCV) core protein or a fragment, derivative, variant or homologue thereof.
    Type: Application
    Filed: October 9, 2001
    Publication date: August 22, 2002
    Inventors: Ralph Graham Hope, John McLauchlan
  • Protein fragments for use in protein targeting
    Patent number: 6340577
    Abstract: A protein is described. The protein comprises a lipid globule targeting sequence linked to a protein of interest (POI) wherein the targeting sequence comprises a hepatitis C virus (HCV) core protein or fragment or homologue thereof.
    Type: Grant
    Filed: December 1, 1998
    Date of Patent: January 22, 2002
    Assignee: Medical Research Council
    Inventors: Ralph Graham Hope, John McLauchlan
  • Anti-herpesviral agents and assays therefor
    Patent number: 6200577
    Abstract: There is described an antiviral agent capable of disrupting the association of two viral structural proteins required for maturation, replication and infection of herpesviruses. The agents are based upon VP22 and disrupt the normal association of that protein with VP16 and/or gB. Suitable agents are peptides having the amino acid sequences TPRVAGFNKRVFCAAVGRLAAMHARMAAVQLW or ITTIRVTVCEGKNLLQRANE. The agents are suitable for combatting infection of herpesviruses and thus for the treatment of cod sores, genital herpes, chickenpox and shingles. An assay to test for agents able to disrupt VP22/V16 and/or VP22/gB association is also described.
    Type: Grant
    Filed: January 25, 1999
    Date of Patent: March 13, 2001
    Assignee: Medical Research Council
    Inventors: John McLauchlan, Duncan James McGeoch, Ralph Graham Hope, Helen Winton McLaren Rixon