Patents by Inventor Robert L. Fine

Robert L. Fine has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • C-terminal p53 palindromic peptide that induces apoptosis of cells with aberrant p53 and uses thereof
    Patent number: 7772367
    Abstract: Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.
    Type: Grant
    Filed: January 27, 2005
    Date of Patent: August 10, 2010
    Assignee: The Trustees of Columbia University in the City of New York
    Inventors: Robert L. Fine, Paul Brandt-Rauf, Yueha Mao
  • Reducing pesticide resistance
    Patent number: 5648085
    Abstract: Pest populations that have developed pesticide resistance can be treated and killed with an inhibitor for ATP-dependent 150-180 kDa membrane P-glycoprotein as a pretreatment or simultaneously with application of a pesticide at doses which, by themselves, are not toxic to the pests.
    Type: Grant
    Filed: March 15, 1995
    Date of Patent: July 15, 1997
    Assignee: Duke University
    Inventors: Christine L. Lanning, Mohammed B. Abou-Donia, Robert L. Fine, James J. Corcoran
  • Aminoanthraquinone derivatives to combat multidrug resistance
    Patent number: 5436243
    Abstract: Potentiating agents inhibit the development of multidrug resistance, reduce drug-resistance in drug-resistant tumors, or sensitize tumors to antineoplastic drugs, thereby potentiating the effect of antineoplastic agents. The potentiating agents are aminoanthraquinones, preferably 1,4-bis(N-substituted) amino anthraquinones, and pharmaceutically acceptable salts thereof.
    Type: Grant
    Filed: November 17, 1993
    Date of Patent: July 25, 1995
    Assignees: Research Triangle Institute Duke University, Pharmaceuticals Corporation
    Inventors: Clifford W. Sachs, Robert L. Fine, Lawrence M Ballas, R. Ivy Carroll, Robert Bell