Abstract: Systems and methods for reslicing data in a representation of a relational database are disclosed. In one embodiment, the database includes a representation including a first slice. The database system creates a plurality of new slice and to create a plurality of write queues. The database system copies units of data in the first slice to the new slices according to a distribution function. The distribution function determines, for each unit of data in the first slice, one of the new slices into which to copy the unit of data. The database system asynchronously writes one or more actions of a set of one or more asynchronous database transactions to the first slice when copying the data in the first slice to the new slices. The database asynchronously enqueues the one or more actions of the set of asynchronous database transactions in the write queues according to the distribution function.

Abstract: Systems and methods for redistributing data in a relational database are disclosed. In one embodiment, the database includes a plurality of rows of data distributed across a plurality of slices of a table in the database. The database system is configured to distribute the rows of data across the slices according to a first function based on one or more columns of the table. The database system monitors at least one database statistic indicative of variation in a distribution of the rows of data across the slices and detects a redistribution condition based on the at least one monitored database statistic. The database system is further configured to respond to the detected redistribution condition by redistributing the rows of data across the slices according to a second function based on a different number of columns than the first function.

Abstract: Systems and methods for redistributing data in a relational database are disclosed. In one embodiment, the database includes a plurality of rows of data distributed across a plurality of slices of a table in the database. The database system is configured to distribute the rows of data across the slices according to a first function based on one or more columns of the table. The database system monitors at least one database statistic indicative of variation in a distribution of the rows of data across the slices and detects a redistribution condition based on the at least one monitored database statistic. The database system is further configured to respond to the detected redistribution condition by redistributing the rows of data across the slices according to a second function based on a different number of columns than the first function.

Abstract: Systems and methods for reslicing data in a representation of a relational database are disclosed. In one embodiment, the database includes a representation including a first slice. The database system creates a plurality of new slice and to create a plurality of write queues. The database system copies units of data in the first slice to the new slices according to a distribution function. The distribution function determines, for each unit of data in the first slice, one of the new slices into which to copy the unit of data. The database system asynchronously writes one or more actions of a set of one or more asynchronous database transactions to the first slice when copying the data in the first slice to the new slices. The database asynchronously enqueues the one or more actions of the set of asynchronous database transactions in the write queues according to the distribution function.

Abstract: Systems and methods for reslicing data in a representation of a relational database are disclosed. In one embodiment, the database includes a representation including a first slice. The database system creates a plurality of new slice and to create a plurality of write queues. The database system copies units of data in the first slice to the new slices according to a distribution function. The distribution function determines, for each unit of data in the first slice, one of the new slices into which to copy the unit of data. The database system asynchronously writes one or more actions of a set of one or more asynchronous database transactions to the first slice when copying the data in the first slice to the new slices. The database asynchronously enqueues the one or more actions of the set of asynchronous database transactions in the write queues according to the distribution function.

Abstract: Systems and methods for redistributing data in a relational database are disclosed. In one embodiment, the database includes a plurality of rows of data distributed across a plurality of slices of a table in the database. The database system is configured to distribute the rows of data across the slices according to a first function based on one or more columns of the database. The database system monitors at least one database statistic indicative of variation in a distribution of the rows of data across the slices and detects a redistribution condition based on the at least one monitored database statistic. The database system is further configured to respond to the detected redistribution condition by redistributing the rows of data across the slices according to a second function based on a different number of columns than the first function.

Abstract: Systems and methods for reslicing data in a representation of a relational database are disclosed. In one embodiment, the database includes a representation including a first slice. The database system creates a plurality of new slice and to create a plurality of write queues. The database system copies units of data in the first slice to the new slices according to a distribution function. The distribution function determines, for each unit of data in the first slice, one of the new slices into which to copy the unit of data. The database system asynchronously writes one or more actions of a set of one or more asynchronous database transactions to the first slice when copying the data in the first slice to the new slices. The database asynchronously enqueues the one or more actions of the set of asynchronous database transactions in the write queues according to the distribution function.

Abstract: Systems and methods for redistributing data in a relational database are disclosed. In one embodiment, the database includes a plurality of rows of data distributed across a plurality of slices of a table in the database. The database system is configured to distribute the rows of data across the slices according to a first function based on one or more columns of the database. The database system monitors at least one database statistic indicative of variation in a distribution of the rows of data across the slices and detects a redistribution condition based on the at least one monitored database statistic. The database system is further configured to respond to the detected redistribution condition by redistributing the rows of data across the slices according to a second function based on a different number of columns than the first function.

Abstract: A strain of hepatitis E virus from Pakistan (SAR-55) implicated in an epidemic of enterically transmitted non-A, non-B hepatitis, now called hepatitis E, is disclosed. The invention relates to the expression of the whole structural region of SAR-55, designated open reading frame 2 (ORF-2), in a eukaryotic expression system. The expressed protein is capable of forming HEV virus-like particles which can serve as an antigen in diagnostic immunoassays and as an immunogen or vaccine to protect against infection by hepatitis E.

Abstract: A strain of hepatitis E virus from Pakistan (SAR-55) implicated in an epidemic of enterically transmitted non-A, non-B hepatitis, now called hepatitis E, is disclosed. The invention relates to the expression of the whole structural region of SAR-55, designated open reading frame 2 (ORF-2), in a eukaryotic expression system. The expressed protein is capable of forming HEV virus-like particles which can serve as an antigen in diagnostic immunoassays and as an immunogen or vaccine to protect against infection by hepatitis E.

Abstract: A strain of hepatitis E virus from Pakistan (SAR-55) implicated in an epidemic of enterically transmitted non-A, non-B hepatitis, now called hepatitis E, is disclosed. The invention relates to the expression of the whole structural region of SAR-55, designated open reading frame 2 (ORF-2), in a eukaryotic expression system. The expressed protein is capable of forming HEV virus-like particles which can serve as an antigen in diagnostic immunoassays and as an immunogen or vaccine to protect against infection by hepatitis E.

Abstract: The invention relates to the expression of open reading frame 2 (ORF-2) proteins of a strain of hepatitis E virus from Pakistan (SAR-55) in a eukaryotic expression system. The expressed proteins can serve as an antigen in diagnostic immunoassays and/or as an immunogen or vaccine to protect against infection by hepatitis E.

Abstract: A strain of hepatitis E virus from Pakistan (SAR-55) implicated in an epidemic of enterically transmitted non-A, non-B hepatitis, now called hepatitis E, is disclosed. The invention relates to the expression of the whole structural region of SAR-55, designated open reading frame 2 (ORF-2), in a eukaryotic expression system. The expressed protein is capable of forming HEV virus-like particles which can serve as an antigen in diagnostic immunoassays and as an immunogen or vaccine to protect against infection by hepatitis E.

Abstract: A strain of hepatitis E virus from Pakistan (SAR-55) implicated in an epidemic of enterically transmitted non-A, non-B hepatitis, now called hepatitis E, is disclosed. The invention relates to the expression of the whole structural region of SAR-55, designated open reading frame 2 (ORF-2), in a eukaryotic expression system. The expressed protein is capable of forming HEV virus-like particles which can serve as an antigen in diagnostic immunoassays and as an immunogen or vaccine to protect against infection by hepatitis E.

Abstract: The present invention relates, in general, to a substantially pure preparation of the simian hepatitis A viral isolate AGM-27; a substantially pure preparation of the genomic DNA of simian hepatitis A viral isolate AGM-27; a pharmaceutical composition comprising the simian hepatitis A viral isolate AGM-27; a method of preventing hepatitis A in an animal; and a vaccine comprising the simian hepatitis A viral isolate AGM-27.

Abstract: The invention relates to the expression of open reading frame 2 (ORF-2) proteins of a strain of hepatitis E virus from Pakistan (SAR-55) in a eukaryotic expression system. The expressed proteins can serve as an antigen in diagnostic immunoassays and/or as an immunogen or vaccine to protect against infection by hepatitis E.

Abstract: A recombinant plasmid DVA pVN22 coding the biosynthesis of a human leukocyte interferon .alpha.-I1 having size of 10.85 t.p.b. and consisting of the following units:EcoRI--HindIII--a fragment of the plasmid pAYC37 with the size of 9.45 t.p.b.,HindIII--EcoRI--a fragment with the size of 1.4 t.p.b. consisting of the following members:a fragment of DNA with the size of 0.25 t.p.b. with the regulatory range of gene D of the phague .phi..times.174 and the first codons of the gene of interferongene of interferon .alpha.-I1 with the size of 0.5 t.p.b.,a region of the human genome DNA with the size of 0.65 t.p.b.;it has the following genetic markers: genome Ap.sup.R ensuring resistance against ampicillin, genome Sm.sup.R ensuring resistance to streptomycin; contains unique regions of recognition of restrictases: Hind III--O; EcoRI--1.4 t.p.b., BamHI--10.82 t.p.b., it is deposited at the collection of culture of microogranisms of the A11-Union Research Institute of Antibiotics and registered under the entry No. 1788.

Abstract: The human leukocyte interferon is essentially a protein featuring the foling sequence of aminoacids:CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAF HEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNE DSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD.A method for producing said interferon N is bacterial cells incorporates isolation of matrix poly (A)-mRNA from induced human leukocytes, synthesis of the gene of said interferon, insertion in the vector plasmid pBR 322 under the control of a tryptophane promotor, and transformation of the resultant recombinant DNA of the E. coli bacterial cells.According to the invention, used as the interferon gene is the gene of interferon N featuring the following primary structure of DNA: ##STR1## The human leukocyte interferon features an antiviral potency and can find application in medical practice.

Abstract: A method for producing human leukocyte interferon alpha-2 resides in that there is carried out submerged cultivation of a producer strain Pseudomonas species VG-84 carrying a plasmid pVG3 with an inserted gene of human leukocyte interferon alpha-2, said strain being deposited in the collection of microorganism cultures at the USSR Antibiotics Research Institute under Reg. No. 1742; said strain being cultivated in a nutrient medium, containing the sources of carbon and nitrogen, mineral salts and growth stimulants, under aeration in the presence of antibiotics, i.e., streptomycin or tetracycline, or a mixture of both, followed by isolation and purification of the end product.