Abstract: The present invention relates to a method for preparing oligosaccharides which can be used among others as food additives to reduce calorie content, to sweeten food products, to increase the fiber content of food products, to improve the texture of food products and to stimulate the gut microbiome bacteria. Furthermore they can be applied in the fields of animal feed, or other applications. More particularly, this invention is directed to a high temperature hydrolysis of xyloglucan polysaccharide to defined xyloglucan oligosaccharides. The invention further relates to oligosaccharide hydrolysates produced with the method of the invention and to the use of said oligosaccharide hydrolysates in human and/or animal nutrition, as prebiotic or other uses. Further provided are novel endoglucanases for use in the method of the invention as well as in other applications.

Abstract: A system with sensor equipment including one or more sensors and watering equipment disposed on a parcel of land and configured to selectively apply water to the parcel, and a gateway configured to provide for communication with the sensor equipment and the watering equipment. The watering equipment comprises a watering pump, wherein the watering pump is operably coupled to a water source and a water line to alternately couple the water source to and isolate the water source from the water line. The watering pump further includes a pump sensor assembly configured to direct the watering pump based on detected environmental and operational parameters.

Abstract: The present invention relates to a method for preparing oligosaccharides which can be used among others as food additives to reduce calorie content, to sweeten food products, to increase the fiber content of food products, to improve the texture of food products and to stimulate the gut microbiome bacteria. Furthermore they can be applied in the fields of animal feed, or other applications. More particularly, this invention is directed to a high temperature hydrolysis of xyloglucan polysaccharide to defined xyloglucan oligosaccharides. The invention further relates to oligosaccharide hydrolysates produced with the method of the invention and to the use of said oligosaccharide hydrolysates in human and/or animal nutrition, as prebiotic or other uses. Further provided are novel endoglucanases for use in the method of the invention as well as in other applications.

Abstract: The invention relates to a method and devices for producing products (65) by using cellulose-containing particles, with which the following steps are carried out: a) irradiating the particles with electrons in the energy range >1 MeV: b) mixing the irradiated particles with electron-beam-reactive powder of a synthetic polymer, in particular a thermoplastic, having powder particle sizes <2000 micrometres and/or with a liquid electron-beam-reactive synthetic or bio-based polymer; c) forming the mixture created in a way corresponding to the form of the product to be produced, in particular forming it into a nonwoven (56): d) heating the formed mixture to 100-180° C.; e) pressing the formed mixture without heating; and f) irradiating the pressed mixture with electrons in the energy range of 1 MeV to 10 Me V and also with appropriately chosen dosages and dosing rates.

Abstract: The invention relates to a target approach method with a long-range optical device comprising an observation optics, a distance measuring device and an orientation determination device, wherein a reference position with a reference distance and a reference angle to the target at a target position is targeted at an intermediate position in an adaptation step by means of the observation optics, while a difference angle between an absolute direction and a reference direction of the long-range optical device is determined by means of the orientation determination device, and a difference distance from the intermediate position to the reference position is determined by means of the distance measuring device, and a target distance and a target angle are determined from the reference distance and the difference distance as well as from the reference angle and the difference angle by a geodetic calculation module.

Abstract: A system with sensor equipment including one or more sensors and watering equipment disposed on a parcel of land and configured to selectively apply water to the parcel, and a gateway configured to provide for communication with the sensor equipment and the watering equipment. The watering equipment comprises a watering pump, wherein the watering pump is operably coupled to a water source and a water line to alternately couple the water source to and isolate the water source from the water line. The watering pump further includes a pump sensor assembly configured to direct the watering pump based on detected environmental and operational parameters.

Abstract: The present invention relates to a method for impregnating concrete with a non-aqueous electrolyte characterized in that an electric field is applied between electrodes mounted on the concrete surface and/or embedded in the concrete such that the non-aqueous electrolyte migrates into the concrete. Preferably, lithium ions are dissolved in the non-aqueous electrolyte.

Abstract: A system (10) with sensor equipment (30) including one or more sensors (140,142) and watering equipment (20) disposed on a parcel of land and configured to selectively apply water to the parcel, and a gateway (40) configured to provide for communication with the sensor equipment (30) and the watering equipment (20). The watering equipment (20) comprises a watering pump (120), wherein the watering pump (120) is operably coupled to a water source (100) and a water line (110) to alternately couple the water source (100) to and isolate the water source (100) from the water line (110). The watering pump (120) further includes a pump sensor assembly (155) configured to detect environmental and operational parameters and processing circuitry (160) configured to direct the watering pump (120) based on detected environmental and operational parameters.

Abstract: The present invention relates to novel polypeptides with xylanase activity, especially xylanase variants, such as genetically engineered xylanase variants, which show improved thermostability, improved resistance against acid treatment and increased enzyme activity on arabinoxylan. The invention includes the use of said polypeptides in applications, such as for food or feed, for brewing or malting, for the treatment of xylan containing raw materials like grain-based materials, e.g. for the production of biofuels or other fermentation products, including biochemicals, and/or for the wheat gluten-starch separation industry, and methods using these polypeptides, as well as compositions (such as feed additive compositions) comprising said polypeptides.

Abstract: A mutant ?-glucosidase polypeptide exhibits enhanced thermostability and has the amino acid sequence: MAKFPRDFVWGTATSSYQIEGAVNEDGRTPSIWDTFSKTX1GKTYKGHT GDVACDHYHRYKEDVEILKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDF YKKLIDELQKRDIX2PAATIYHWDLPQWAYDKGGGWLNRESIKWYVEYA TKLFEELGDAIPLWITHNEPWCSSILSYGIGEHAPGHKNYREALIAAHH ILLSHGEAVKAFREMNIKGSKIGITLNLTPAYPASEKEEDKLAAQYADG FANRWELDPIFKGNYPEDMMELYSKIIGEFDFIKEGDLETISVPIDFLG X3NYYTRSIVKYDEDSMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD REYTKLPMYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIGE GGNLKGYFVWSLMDNFEWAHGYSKRFGIVYVDYX4TQKRILKDSALWYK EVIX5DDGIED, wherein X1 is selected from E, P, T, M, A, S and G; X2 is selected from V, K, R and H; X3 is selected from I, L, M, P, T and A; X4 is selected from T, E, D, N, Q, M and P; and X5 is selected from L, R, K and H.

Abstract: The present invention relates to a method for preparing oligosaccharides which can be used among others as food additives to reduce calorie content, to sweeten food products, to increase the fiber content of food products, to improve the texture of food products and to stimulate the gut microbiome bacteria. Furthermore they can be applied in the fields of animal feed, or other applications. More particularly, this invention is directed to a high temperature hydrolysis of xyloglucan polysaccharide to defined xyloglucan oligosaccharides. The invention further relates to oligosaccharide hydrolysates produced with the method of the invention and to the use of said oligosaccharide hydrolysates in human and/or animal nutrition, as prebiotic or other uses. Further provided are novel endoglucanases for use in the method of the invention as well as in other applications.

Abstract: The present invention relates to a method for the preparation of a food product comprising rye, which comprises the steps of preparing a primary food mixture; adding to said primary food mixture a composition comprising at least one glycoside hydrolase family 10 (GH10) enzyme; and processing said primary food mixture to produce said food product comprising rye. The invention further provides GH10 enzymes, compositions comprising said enzymes and the use of said enzymes and said composition in preparing food products.

Abstract: A writing, marking and/or drawing liquid, more particularly an aqueous, pigmented and/or water-blendable writing, marking and/or drawing liquid, is provided for capillary systems, more particularly for applicator implements having a capillary system. The liquid has a viscosity of less than 40 mPas, more particularly less than 10 mPas (Brookfield, 20° C., cone-plate CPE-40) and includes an aqueous pigment preparation, a binder, a base, and a dispersing wetting agent. The dispersing wetting agent includes an aqueous solution of a modified polymer having groups with pigment affinity. An applicator implement in which a writing, marking or drawing liquid of this kind is used is also provided.

Abstract: Disclosed is an anode assembly for the corrosion protection of metal parts embedded in concrete. An ion-conducting material is placed between the metal part that is to be protected and the anode, which ion-conducting material exhibits higher ionic conductivity than the surrounding concrete, thus directing the protective current specifically towards the metal part. A galvanic sacrificial anode may be provided, made, e.g., from zinc and its alloys or aluminum and its alloys. The purpose of the material with higher ionic conductivity than the surrounding concrete is to selectively direct the protective galvanic current towards the metal part that is to be protected. The selective enhanced corrosion protection is especially beneficial for the protection of metal parts that are highly important for the structural integrity of concrete members, such as assembly of pre- or post-tensioning of concrete members, such as anchor-heads.

Abstract: A writing, marking and/or drawing liquid for writing implements, especially for capillary pens, which has a viscosity of less than 50 mPas (Brookfield, 20° C., CPE-40 plate-cone), contains a resin mixture dissolved in a solvent matrix having at least one solvent. Wherein the resin mixture contains a first resin in the form of a modified resin ester and/or a dissolved polyester resin and a second resin in the form of a maleate resin and/or a rosin, especially a phenol-modified rosin. Additives are present in the form of at least one fluorosurfactant as wetter and at least one polyethersiloxane copolymer as glidant.

Abstract: A galvanic anode system for the corrosion protection of steel in concrete includes a galvanic anode material, which includes of zinc and alloys thereof, embedded in a solid electrolyte, and is characterized in that the galvanically available surface is larger, preferably at least twice as large, as the total geometrical surface of the metal anode. The galvanic anode system is also characterized in that, during operation, during which the anode disintegrates as a sacrificial anode, the galvanically active anode surface is reduced only slightly, preferably is not reduced up to at least 50%, in particular 75%, of the time during use.

Abstract: A system (10) with sensor equipment (30) including one or more sensors (140,142) and watering equipment (20) disposed on a parcel of land and configured to selectively apply water to the parcel, and a gateway (40) configured to provide for communication with the sensor equipment (30) and the watering equipment (20). The watering equipment (20) comprises a watering pump (120), wherein the watering pump (120) is operably coupled to a water source (100) and a water line (110) to alternately couple the water source (100) to and isolate the water source (100) from the water line (110). The watering pump (120) further includes a pump sensor assembly (155) configured to detect environmental and operational parameters and processing circuitry (160) configured to direct the watering pump (120) based on detected environmental and operational parameters.

Abstract: The invention relates to mutant variants of the ?-glucosidase Cgl T from Thermoanaerobacter brockii and nucleic acids for producing the same. Said mutant variants show significantly increased thermostability and enzyme activity. Furthermore, the invention provides vectors, host cells and methods for producing said mutant variants of the ?-glucosidase Cgl T. Also provided are artificial cellulosomes comprising the mutant variants of the ?-glucosidase Cgl T and methods for the enzymatic hydrolysis of cellulosic biomass comprising said artificial cellulosomes and/or said mutant variants of the ?-glucosidase Cgl T.

Abstract: The invention relates to a target approach method with a long-range optical device comprising an observation optics, a distance measuring device and an orientation determination device, wherein a reference position with a reference distance and a reference angle to the target at a target position is targeted at an intermediate position in an adaptation step by means of the observation optics, while a difference angle between an absolute direction and a reference direction of the long-range optical device is determined by means of the orientation determination device, and a difference distance from the intermediate position to the reference position is determined by means of the distance measuring device, and a target distance and a target angle are determined from the reference distance and the difference distance as well as from the reference angle and the difference angle by a geodetic calculation module.

Abstract: A tailpipe cover is provided for an exhaust system of a motor vehicle, including a cover pipe having a pipe axis, which can be fitted onto a tailpipe of the exhaust system, a plurality of fastening elements arranged on a radial inner side of the cover pipe for fixing the tailpipe cover to the tailpipe in a radial and axial direction, and a positioning element arranged on a radial inner side of the cover pipe for positioning the tailpipe cover in a circumferential direction relative to the tailpipe.