Patents by Inventor Yu Ogawa
Yu Ogawa has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 12006997Abstract: A damper device including an input element to which a torque from an engine is transmitted; an output element; an elastic body to transmit torque between the input element and the output element; and rotary inertia mass damper having a mass body that rotates in accordance with a relative rotation of the input element and the output element. The output element is coupled to a rotor of an electric motor, which is coupled to an input shaft of a transmission. The rotary inertia mass damper includes a planetary gear mechanism having a carrier that supports pinion gears, the carrier is a part of the input element, one of the sun gear and the ring gear is a part of the output element, and the other of the sun gear and the ring gear functions as the mass body.Type: GrantFiled: December 26, 2019Date of Patent: June 11, 2024Assignees: AISIN CORPORATION, AISIN AW INDUSTRIES CO., LTD.Inventors: Takuya Yoshikawa, Tomonori Kinoshita, Akiyoshi Kato, Ryosuke Otsuka, Yoichi Oi, Yu Mizukami, Aki Ogawa
-
Publication number: 20240150657Abstract: The purpose of the present invention is to provide a novel anthraquinone compound, and to provide: a dichroic dye constituted of the novel anthraquinone compound; a liquid crystal composition which contains the dichroic dye; and preferably a dimming element having excellent contrast and light resistance and containing said composition. The present invention discloses an anthraquinone compound represented by formula A below (wherein R1 represents a C3-16 branched alkyl group, and R2 represents a hydrogen atom, a C1-8 straight-chain or branched alkyl group, or a C1-8 straight-chain or branched alkoxy group). In addition, the present invention discloses a liquid crystal composition including the anthraquinone compound and a liquid crystal material, and a dimming element containing said composition.Type: ApplicationFiled: March 8, 2022Publication date: May 9, 2024Inventors: Kanae Ogawa, Kohei Ohtani, Saori Suzuki, Hitomi Muto, Masakazu Shiraishi, Yu Hattori
-
Publication number: 20240138057Abstract: A flexible wiring board includes a signal line that transmits a signal and an electroconductive layer that is disposed to face the signal line, wherein the electroconductive layer includes a first portion in which a plurality of openings are provided, and a linear second portion that is formed in at least one of the plurality of openings, that has, at one end thereof, a connection portion connected to the first portion, and whose other end is an open end, where the connection portion is disposed in the second portion on a sending side in a transmission direction of a signal through the signal line. An angle between a direction along the transmission direction of the signal and an extension direction of the second portion from the connection portion toward the open end is an acute angle or an obtuse angle.Type: ApplicationFiled: October 18, 2023Publication date: April 25, 2024Inventors: TOSHIYUKI YOSHIDA, YU OGAWA
-
Publication number: 20240119475Abstract: An information processing device includes a processor configured to provide an incentive to a first user who sells or returns a first vehicle in which a part of a first coating film including an easily peelable layer is not peeled off.Type: ApplicationFiled: December 19, 2023Publication date: April 11, 2024Applicant: TOYOTA JIDOSHA KABUSHIKI KAISHAInventors: Yukinori II, Kenji YAMAGUCHI, Junya OGAWA, Yuki NAGANUMA, Junya YAMAMOTO, Yuta TONE, Naoki ISHIZUKA, Tadayuki TANAKA, Keisuke ITO, Yuka YOKOI, Takashi HAYASHI, Naoya OKA, Yu HAMADA
-
Publication number: 20240121885Abstract: A wiring board includes a wiring layer, a shield layer, and an insulating layer. The wiring layer includes at least one signal line and at least one ground line. The shield layer overlaps the wiring layer in plan view. The insulating layer is provided between the wiring layer and the shield layer. The insulating layer includes at least one end portion surrounded by the insulating layer. The at least one end portion is located on at least the at least one ground line. A connection conductor line electrically connecting the shield layer to the at least one ground line is provided on part of the at least one end portion.Type: ApplicationFiled: October 3, 2023Publication date: April 11, 2024Inventors: YU OGAWA, TOSHIYUKI YOSHIDA
-
Publication number: 20230248854Abstract: The production method of a radioactive metal-labeled antibody of the present invention includes a step of conducting a click reaction of a radioactive metal complex and an antibody site-specifically modified with a peptide to produce a radioactive metal-labeled antibody. The click reaction is performed between a first atomic group of the radioactive metal complex and a second atomic group directly or indirectly linked to the peptide. The second atomic group is an atomic group containing an azide group, or an atomic group containing trans-cyclooctene.Type: ApplicationFiled: October 16, 2020Publication date: August 10, 2023Applicant: NIHON MEDI-PHYSICS CO., LTD.Inventors: Akihiro IZAWA, Yu OGAWA, Hiroaki ICHIKAWA, Minoru KAWATANI, Hideaki TAKEMORI, Yuki OKUMURA
-
Patent number: 11701440Abstract: Described is a labeling technique which can facilitate the metabolism in the liver after administration to patients without the reduction in the antibody function, thereby reducing accumulation of radionuclides in an organ such as the liver, and a modified antibody containing an IgG antibody and an IgG-binding peptide bound to the IgG antibody. The IgG-binding peptide has an amino acid sequence consisting of 13 to 17 amino acid residues, such as GPDCAYH(Xaa1)GELVWCTFH (SEQ ID NO: 2) wherein Xaa1 represents a lysine residue, a cysteine residue, an aspartic acid residue, a glutamic acid residue, 2-aminosuberic acid, or diaminopropionic acid, and a compound represented by the following formula (II-1) is linked at a position of the lysine residue via a modification linker to the N terminus of the IgG-binding peptide.Type: GrantFiled: April 15, 2019Date of Patent: July 18, 2023Assignees: NIHON MEDI-PHYSICS CO., LTD., NATIONAL UNIVERSITY CORPORATION KAGOSHIMA UNIVERSITY, NATIONAL UNIVERSITY CORPORATION CHIBA UNIVERSITYInventors: Shota Komoto, Yu Ogawa, Yoshinari Shoyama, Tadashi Hatano, Yuji Ito, Yasushi Arano, Hiroyuki Suzuki, Tomoya Uehara
-
Publication number: 20230036379Abstract: A flexible wiring board includes a signal line and a conductive portion that overlaps the signal line in plan view. The conductive portion includes a first line portion extending in a first direction and having a first part and a second part, a second line portion extending in a second direction and having a third part and a fourth part, and a third line portion. The third line portion has a line width smaller than a line width of the first part and a line width of the second part, is connected to the first and second parts, and is provided between the first part and the second part. The conductive portion includes a fourth line portion that is connected to the third part and the fourth part and that is provided between the third part and the fourth part. The third line portion and the fourth line portion intersect.Type: ApplicationFiled: July 29, 2022Publication date: February 2, 2023Inventors: Toshiyuki Yoshida, Yu Ogawa
-
Patent number: 11553586Abstract: A wiring substrate which includes a base member having a first surface, a first differential signal line disposed on the first surface of the base member and a second differential signal line disposed adjacent to the first differential signal line on the first surface of the base member. A ground layer which faces the first and second differential signal lines, has a plurality of openings continuously arranged along a predetermined direction. In a planar view of the wiring substrate, where a length of each of the plurality of openings in a direction along the signal lines is a length L1, a length of the opening in a direction orthogonal to Li is a length L2, and a distance between the first and second differential signal lines is a length L3, L1 is equal to or greater than four times L2, and L2 is equal to or less than L3.Type: GrantFiled: December 4, 2020Date of Patent: January 10, 2023Assignee: Canon Kabushiki KaishaInventors: Toshiyuki Yoshida, Yu Ogawa, Shoji Matsumoto
-
Publication number: 20220400547Abstract: A wiring board includes a signal line, a shield member whose main surface extends along the signal line, and a branch line that is electrically connected to the shield member, that includes a leading end that is opened, and that extends in a direction parallel with the main surface of the shield member.Type: ApplicationFiled: June 1, 2022Publication date: December 15, 2022Inventors: Makoto Aoki, Tomohisa Ishigami, Yu Ogawa
-
Patent number: 11291373Abstract: A temperature sensor (210) measures a temperature inside clothes being a temperature inside the clothes worn by a user. The acceleration sensor (220) detects acceleration applied to the user. A processing device (100) estimates a deep body temperature that is a temperature inside the body of the user based on the temperature inside the clothes measured by the temperature sensor (210) and an acceleration detected by the acceleration sensor (220).Type: GrantFiled: June 15, 2018Date of Patent: April 5, 2022Assignee: TEIJIN LIMITEDInventors: Tasuku Kimura, Hirokazu Hayashi, Ryo Yasumitsu, Hiroshi Nose, Yu Ogawa
-
Publication number: 20210185798Abstract: A wiring substrate which includes a base member having a first surface, a first differential signal line disposed on the first surface of the base member and a second differential signal line disposed adjacent to the first differential signal line on the first surface of the base member. A ground layer which faces the first and second differential signal lines, has a plurality of openings continuously arranged along a predetermined direction. In a planar view of the wiring substrate, where a length of each of the plurality of openings in a direction along the signal lines is a length L1, a length of the opening in a direction orthogonal to L1 is a length L2, and a distance between the first and second differential signal lines is a length L3, L1 is equal to or greater than four times L2, and L2 is equal to or less than L3.Type: ApplicationFiled: December 4, 2020Publication date: June 17, 2021Inventors: Toshiyuki Yoshida, Yu Ogawa, Shoji Matsumoto
-
Publication number: 20210170058Abstract: The present invention relates to a labeling technique which can facilitate the metabolism in the liver after administration to patients without the reduction in the antibody function, thereby reducing accumulation of radionuclides in an organ such as the liver, and provides a modified antibody containing an IgG antibody and an IgG-binding peptide bound to the IgG antibody. The IgG-binding peptide has an amino acid sequence consisting of 13 to 17 amino acid residues, such as GPDCAYH(Xaa1)GELVWCTFH wherein Xaa1 represents a lysine residue, a cysteine residue, an aspartic acid residue, a glutamic acid residue, 2-aminosuberic acid, or diaminopropionic acid, and a compound represented by the following formula (II-1) is linked at a position of the lysine residue via a modification linker to the N terminus of the IgG-binding peptide.Type: ApplicationFiled: April 15, 2019Publication date: June 10, 2021Applicants: NIHON MEDI-PHYSICS CO., LTD., National University Corporation Kagoshima University, National University Corporation Chiba UniversityInventors: Shota KOMOTO, Yu OGAWA, Yoshinari SHOYAMA, Tadashi HATANO, Yuji ITO, Yasushi ARANO, Hiroyuki SUZUKI, Tomoya UEHARA
-
Publication number: 20200367758Abstract: A temperature sensor (210) measures a temperature inside clothes being a temperature inside the clothes worn by a user. The acceleration sensor (220) detects acceleration applied to the user. A processing device (100) estimates a deep body temperature that is a temperature inside the body of the user based on the temperature inside the clothes measured by the temperature sensor (210) and an acceleration detected by the acceleration sensor (220).Type: ApplicationFiled: June 15, 2018Publication date: November 26, 2020Applicant: TEIJIN LIMITEDInventors: Tasuku KIMURA, Hirokazu HAYASHI, Ryo YASUMITSU, Hiroshi NOSE, Yu OGAWA
-
Publication number: 20150231284Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DESK*?QMEEEAVRLFIEVVLK*?NGGPSSGAPPPSK-NH2?(1) *-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(2) *-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(3) *-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(4), wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.Type: ApplicationFiled: March 30, 2015Publication date: August 20, 2015Applicants: ARKRAY, INC., KYOTO UNIVERSITYInventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20140127128Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.Type: ApplicationFiled: December 17, 2013Publication date: May 8, 2014Applicants: ARKRAY, INC., KYOTO UNIVERSITYInventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa
-
Patent number: 8642008Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.Type: GrantFiled: August 31, 2010Date of Patent: February 4, 2014Assignees: Kyoto University, ARKRAY, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20110059483Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides; polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides; Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B—in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.Type: ApplicationFiled: August 31, 2010Publication date: March 10, 2011Applicants: Kyoto University, ARKRAY, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
-
Publication number: 20110033381Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DLSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (1) ?*-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (2) ??*-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (3) ???*-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2, (4) wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.Type: ApplicationFiled: August 10, 2010Publication date: February 10, 2011Applicants: Kyoto University, ARKRAY, Inc.Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Yu Ogawa, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda