Abstract: Disclosed is a two-way radio frequency (RF) communications system including a first device that receives, from a first subscriber unit, a virtual radio conferencing call (VRC) request identifying a plurality of other subscriber units to be partied to the VRC call and a conference time period during which to conduct the VRC call. The device reserves RF resources at one or more corresponding radio sites associated with the subscriber units partied to the VRC call for the conference time period. At a beginning of the conference time period, the device causes a virtual radio conference call start message to be transmitted to the subscriber units partied to the call instructing the subscriber units to join the VRC call via the reserved RF resources at their respective radio sites.

Abstract: A combined rocker arm apparatus for actuating auxiliary valve of engine, comprises an auxiliary actuator, a main rocker arm and a secondary rocker arm. The auxiliary actuator comprises an auxiliary rocker arm and an auxiliary cam. The auxiliary rocker arm and the main rocker arm are mounted on the rocker arm shaft in parallel. The auxiliary rocker arm is connected to the auxiliary cam at one end and adjacent to the secondary rocker arm at the other end. The auxiliary rocker arm includes a drive mechanism which provided with a piston. In the non-operation mode of the drive mechanism, the piston is drawn back, then the auxiliary rocker arm is disconnected with the secondary rocker arm; in the operation mode of the drive mechanism, the piston is pushed out, then the auxiliary rocker arm is connected with the secondary rocker arm.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lifes and better oxidative resistance to materials than currently available antioxidants.

Abstract: A system and method of actuating one or more engine valves is disclosed. In one embodiment, the system comprises: a valve train element; a rocker arm pivotally mounted on a shaft and adapted to rotate between a first position and a second position, the rocker arm selectively receiving motion from the valve train element; a valve bridge disposed above the one or more engine valves; and a lost motion system disposed in the valve bridge.

Abstract: An auxiliary valve actuating mechanism of an engine includes a first valve actuating mechanism and an auxiliary valve actuating mechanism. The auxiliary valve actuating mechanism comprises an auxiliary cam, an auxiliary rocker-arm shaft, an auxiliary rocker arm, an eccentric rocker arm bushing and a bushing actuation device. One end of the auxiliary rocker arm constitutes a motion pair with the auxiliary cam and the other end is above the valve. The bushing actuation device actuates the eccentric rocker arm bushing to rotate between an operating position and a non-operating position.

Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogues and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lives and better oxidative resistance to materials than currently available antioxidants.

Abstract: A variable valve actuation system to actuate and control the seating velocity of an internal combustion engine valve is disclosed. The system comprises: a housing having a bore formed therein; an outer piston slidably disposed in the bore, the outer piston having an orifice formed therein; a catch piston slidably disposed in the outer piston; and an cone-shaped extension extending from the inner piston, wherein the cone-shaped extension is adapted to provide a variable flow area through the outer piston orifice to provide improved engine valve seating.

Abstract: Methods and systems are disclosed for forcing at least some members of a communication group to join a new group call when they are participating in an another group call to a different communication group. A wireless communication device that seeks to initiate the new group call transmits a request-to-transmit (RTT) on a reverse channel to initiate the new group call. This way, at least some of group members participating in the other group call can be allowed to join the new group call. The recipients of the RTT can then switch from a primary channel on which the other group call is taking place to an alternative channel to join the new group call. In one implemenation, the disclosed embodiments can be applied to a two-way wireless communication system that employs a TDMA channel access scheme.

Abstract: A printed circuit board (PCB) includes two power supply units, a central processing unit (CPU), two inductors and a temperature compensation resistor. One of the inductor is electrically connected between one power supply unit and the CPU, the other inductor is electrically connected between another power supply unit and the CPU. The temperature compensation resistor is electrically connected between the power supply units and ground, and is positioned between the two inductors to adjust output voltage from the CPU.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lifes and better oxidative resistance to materials than currently available antioxidants.

Abstract: A fixed chain engine braking device includes a brake box, a driving mechanism and a braking mechanism. One upright blind hole and one horizontal blind hole are placed in the brake box, and the upright blind hole intersects the horizontal blind hole orthogonally. The driving mechanism includes a rolling ball and/or a driving piston placed in the horizontal blind hole, the braking mechanism includes a braking plunger placed in the upright blind hole. A fluid passage is placed in the brake box, and the fluid passage is communicated with the entry of the horizontal blind hole.

Abstract: An apparatus for dispensing liquid fuel comprises a plurality of inlet valves, each connected in-line with a respective inlet pipe in fluid communication with a respective source of a specific liquid fuel. A plurality of outlet valves are also provided, each connected in-line with a respective outlet pipe. A respective fuel hose is in fluid communication with each of the outlet pipes. The apparatus further comprises a coriolis flow meter located between the inlet valves and outlet valves, the coriolis flow meter providing a flow signal indicative of flow therethrough. A controller is operative to receive the flow signal and control the valves such that selected inputs of specific liquid fuels are dispensed to at least one of the fuel hoses. In accordance with an exemplary embodiment, the selected inputs of specific liquid fuels may include individual liquid fuels and blended combinations thereof.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lifes and better oxidative resistance to materials than currently available antioxidants.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lifes and better oxidative resistance to materials than currently available antioxidants.

Abstract: A variable valve actuation system to actuate and control the seating velocity of an internal combustion engine valve is disclosed. The system comprises: a housing having a bore formed therein; an outer piston slidably disposed in the bore, said outer piston having an internal hydraulic passage, an internal chamber defined by an outer piston side wall, and an internal orifice connecting the internal hydraulic passage and the internal chamber; a catch piston slidably disposed in the outer piston; and a cone-shaped extension extending from the inner piston, wherein the cone-shaped extension is adapted to provide a variable flow area through the outer piston orifice to provide improved engine valve seating.

Abstract: Apparatus and method are disclosed for converting an internal combustion engine from a normal engine operation (20) to an engine braking operation (10). The engine includes exhaust valve train components comprising at least one exhaust valve (300) and at least one cam (230) for cyclically opening and closing the at least one exhaust valve (300). The apparatus comprises actuation means (100) having at least one component integrated into at least one of the exhaust valve train components, such as a rocker arm (210) or a valve bridge (400). The actuation means (100) has an inoperative position and an operative position. In the inoperative position, the actuation means (100) is retracted and the small braking cam lobes (232 & 233) are skipped to generate a main valve lift profile (220m) for the normal engine operation (20).

Abstract: A method of determining whether a measured fuel delivery rate determined by a fuel meter of a fuel dispenser corresponds to an actual fuel delivery rate at which fuel is being dispensed to a vehicle through a fuel flow path. The method includes measuring a fuel delivery rate at a given time during a fueling operation, measuring a fuel pressure of the fuel within the fuel flow path at the given time, comparing the measured fuel pressure to a plurality of fuel pressure values from a data set including a plurality of actual fuel delivery rate values that correspond to the plurality of fuel pressure values, retrieving one of the plurality of actual fuel delivery rate values from the data set that corresponds to the measured fuel pressure value; and comparing the measured fuel delivery rate from the fuel meter to the one actual fuel delivery rate value to determine if the measured fuel delivery rate corresponds to the actual fuel delivery rate at which fuel is being dispensed to the vehicle.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lifes and better oxidative resistance to materials than currently available antioxidants.

Abstract: Apparatus and method are disclosed for converting an internal combustion engine from a normal engine operation (20) to an engine braking (or retarding) operation (10). The apparatus has an actuation means (100) containing two braking pistons (160) slidably disposed in the valve bridge (400) between an inoperative position (0) and an operative position (1). The apparatus also has a flow control valve (50) for supplying control fluid to the actuation means (100) with two levels of pressure. At the first level or lower pressure, the braking pistons (160) will stay in the inoperative position (0), and a gap (234) is formed between the valve bridge (400) and the exhaust valves (300) to skip the motion from the lower portion of the cam (230) for the normal engine operation (20).