TREATING CARDIOVASCULAR OR RENAL DISEASES
This document provides methods and materials for treating cardiovascular and/or renal diseases. For example, AAV9 vectors designed to express natriuretic polypeptides, nucleic acid molecules encoding natriuretic polypeptides, methods for making AAV9 vectors, and methods for using such vectors or molecules to treat cardiovascular and/or renal diseases are provided.
Latest Mayo Foundation for Medical Education and Research Patents:
- Detecting colorectal neoplasm
- MATERIALS AND METHODS FOR TREATING CANCER
- DEVICES, SYSTEMS, AND METHODS FOR DEPLOYING AN ANCHOR INTO TISSUE TO A PRESCRIBED DEPTH
- IMPLANTABLE MEDICAL SYSTEMS FOR CANCER TREATMENT WITH THERMAL MANAGEMENT FEATURES
- DEVICES AND METHODS FOR TREATING TINNITUS USING ELECTRICAL STIMULATION
This invention was made with government support under grant number HL098502 awarded by the National Institutes of Health. The government has certain rights in the invention.
CROSS-REFERENCE TO RELATED APPLICATIONSThis application is a continuation of U.S. application Ser. No. 15/966,288, filed Apr. 30, 2018, which is a continuation of U.S. application Ser. No. 15/436,426 (now U.S. Pat. No. 9,987,331), filed Feb. 17, 2017, which is a continuation of U.S. application Ser. No. 14/370,554 (now U.S. Pat. No. 9,611,305), filed Jul. 3, 2014, which is a National Stage application under 35 U.S.C. § 371 of International Application No. PCT/US2013/020392, having an International Filing Date of Jan. 4, 2013, which claims the benefit of priority to U.S. Provisional Application Ser. No. 61/584,006, filed on Jan. 6, 2012. The disclosures of the prior applications are considered part of (and are incorporated by reference in) the disclosure of this application.
TECHNICAL FIELDThis document relates to methods and materials involved in treating cardiovascular and/or renal diseases. For example, this document relates to adeno-associated virus serotype 9 (AAV9) vectors designed to express natriuretic polypeptides, nucleic acid molecules encoding natriuretic polypeptides, methods for making AAV9 vectors, and methods for using such vectors or molecules to treat cardiovascular and/or renal diseases.
BACKGROUND INFORMATIONHypertension is a highly common condition that, if not controlled, progresses toward more severe cardiovascular and renal morbidity. Its major clinical phenotype is hypertensive heart disease (HHD), which is characterized by diastolic dysfunction, cardiac remodeling, and fibrosis. Over time, diastolic dysfunction evolves into systolic impairment, which leads to the worsening of overall cardiac function and to increased morbidity and mortality.
SUMMARYThis document provides methods and materials for treating cardiovascular and/or renal diseases. For example, this document provides AAV9 vectors designed to express natriuretic polypeptides, nucleic acid molecules encoding natriuretic polypeptides, methods for making AAV9 vectors, and methods for using such vectors or molecules to treat cardiovascular and/or renal diseases. AAV9 was isolated from human tissues and shown to have serological characteristics distinct from previously described serotypes (Gao et al., J. Virol., 78:6381-6388 (2004)).
As described herein, AAV9 vectors can be designed to have a nucleic acid sequence that encodes a natriuretic polypeptide such as an atrial natriuretic polypeptide (ANP), a B-type natriuretic polypeptide (BNP), a C-type natriuretic polypeptide (CNP), or a chimeric natriuretic polypeptide called CDNP. Such AAV9 vectors can be administered to a mammal (e.g., a human patient identified as suffering from a cardiovascular and/or renal disease) to treat that mammal's cardiovascular and/or renal disease. For example, an AAV9 vector provided herein can successfully deliver nucleic acid to cardiac cells for expression (e.g., sustained expression) of a natriuretic polypeptide without any short- or long-term toxicological effects and any signs of tolerance. In some cases, the sustained cardiac natriuretic polypeptide (e.g., BNP or CDNP) overexpression can reduce blood pressure (BP) and improve left ventricular (LV) function after a single administration (e.g., a single intravenous injection). In some cases, the AAV9 vectors provided herein can be used to reduce or prevent the development of hypertensive heart disease (HHD). Having the ability to deliver and express natriuretic polypeptide in cardiac cells as described herein can allow patients and clinicians to treat cardiovascular and/or renal diseases in an efficient and effective manner.
In general, one aspect of this document features an AAV9 vector comprising, or consisting essentially of, a nucleic acid sequence encoding a natriuretic polypeptide. The natriuretic polypeptide can be a human BNP polypeptide. The natriuretic polypeptide can be a CDNP polypeptide. The natriuretic polypeptide can be a B-CDNP polypeptide. The natriuretic polypeptide can be a C-CDNP polypeptide.
In another aspect, this document features a composition comprising, or consisting essentially of, an AAV9 vector in combination with a pharmaceutically acceptable delivery vehicle. The AAV9 vector comprises, or consists essentially of, a nucleic acid sequence encoding a natriuretic polypeptide. The natriuretic polypeptide can be a human BNP polypeptide. The natriuretic polypeptide can be a CDNP polypeptide. The natriuretic polypeptide can be a B-CDNP polypeptide. The natriuretic polypeptide can be a C-CDNP polypeptide.
In another aspect, this document features a method for a cardiovascular or renal disease. The method comprises, or consists essentially of, administering a vector or a composition to a mammal. The vector can be an AAV9 vector comprising, or consisting essentially of, a nucleic acid sequence encoding a natriuretic polypeptide, and the composition can comprise, or consist essentially of, an AAV9 vector in combination with a pharmaceutically acceptable delivery vehicle. The natriuretic polypeptide can be a human BNP polypeptide. The natriuretic polypeptide can be a CDNP polypeptide. The natriuretic polypeptide can be a B-CDNP polypeptide. The natriuretic polypeptide can be a C-CDNP polypeptide. The mammal can be a human.
In another aspect, this document features a method for prolonging survival time for a mammal with hypertensive heart disease. The method comprises, or consists essentially of, administering a vector or a composition to the mammal. The vector can be an AAV9 vector comprising, or consisting essentially of, a nucleic acid sequence encoding a natriuretic polypeptide, and the composition can comprise, or consist essentially of, an AAV9 vector in combination with a pharmaceutically acceptable delivery vehicle. The natriuretic polypeptide can be a human BNP polypeptide. The natriuretic polypeptide can be a CDNP polypeptide. The natriuretic polypeptide can be a B-CDNP polypeptide. The natriuretic polypeptide can be a C-CDNP polypeptide. The mammal can be a human.
In another aspect, this document features a method for improving cardiac function in a mammal with hypertensive heart disease. The method comprises, or consists essentially of, administering a vector or a composition to the mammal under conditions wherein cardiac function is improved at least five months following the administration. For example, cardiac function can be improved for a period of time extending from about five months following the administration to about twelve months following the administration, from about five months following the administration to about ten months following the administration, or from about five months following the administration to about six months following the administration). The vector can be an AAV9 vector comprising, or consisting essentially of, a nucleic acid sequence encoding a natriuretic polypeptide, and the composition can comprise, or consist essentially of, an AAV9 vector in combination with a pharmaceutically acceptable delivery vehicle. The natriuretic polypeptide can be a human BNP polypeptide. The natriuretic polypeptide can be a CDNP polypeptide. The natriuretic polypeptide can be a B-CDNP polypeptide. The natriuretic polypeptide can be a C-CDNP polypeptide. The mammal can be a human.
In another aspect, this document features a method for improving cardiac function in a mammal with polycystic kidney disease. The method comprises, or consists essentially of, administering a vector or a composition to the mammal under conditions wherein cardiac function is improved at least two months following the administration. For example, cardiac function can be improved for a period of time extending from about two months following the administration to about twelve months following the administration, from about two months following the administration to about ten months following the administration, or from about two months following the administration to about five months following the administration). The vector can be an AAV9 vector comprising, or consisting essentially of, a nucleic acid sequence encoding a natriuretic polypeptide, and the composition can comprise, or consist essentially of, an AAV9 vector in combination with a pharmaceutically acceptable delivery vehicle. The natriuretic polypeptide can be a human BNP polypeptide. The natriuretic polypeptide can be a CDNP polypeptide. The natriuretic polypeptide can be a B-CDNP polypeptide. The natriuretic polypeptide can be a C-CDNP polypeptide. The mammal can be a human.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used to practice the invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.
This document provides methods and materials for treating cardiovascular and/or renal diseases. For example, this document provides AAV9 vectors designed to express natriuretic polypeptides, nucleic acid molecules encoding natriuretic polypeptides, methods for making AAV9 vectors, and methods for using such vectors or molecules to treat cardiovascular and/or renal diseases. In some cases, an AAV8 vector can be used in place of an AAV9 vector described herein to obtain an AAV8 vector designed to express one or more natriuretic polypeptides. Such AAV8 vectors can be uses as described herein with respect to AAV9 vectors.
As described herein, an AAV9 vector can be configured to include a nucleic acid sequence that encodes a natriuretic polypeptide. Examples of natriuretic polypeptides that can be expressed using an AAV9 vector as described herein include, without limitation, ANP (e.g., human ANP), BNP (e.g., human BNP), CNP (e.g., human CNP), CDNP, DNP, mANP, and ASBNP. The core amino acid sequence of CDNP can be as follows: GLSKGCFGLKLDRIGSMSGLGCPSLRDPRPNAPSTSA (SEQ ID NO:6). The amino acid sequence for ANP, pre-pro-ANP, mANP, and pre-pro-mANP can be as set forth in
In some cases, an AAV9 vector can be configured to include two or more different nucleic acid sequences that encode natriuretic polypeptides. For example, an AAV9 vector can be configured to include a nucleic acid sequence that encodes human BNP and a nucleic acid sequence that encodes CDNP.
In some cases, the one or more natriuretic polypeptides to be expressed using an AAV9 vector can include the N-terminal region of a natural natriuretic polypeptide that includes non-active components of an active natriuretic polypeptide such as a signal peptide sequence and other sequences that can be involved in polypeptide processing, folding, and stabilization. Examples of such N-terminal regions include, without limitation, those set forth in SEQ ID NO: 1, 4, or 5. In some cases, one or more of the following sequences can be used as an N-terminal region of a natriuretic polypeptide to be expressed using an AAV9 vector: BNP signal peptide+NT-proBNP, CNP signal peptide+NT-proCNP, and ANP signal peptide +NT-proANP. Examples of amino acid sequences encoding a natriuretic polypeptide that includes such an N-terminal region include, without limitation, those amino acid sequences set forth in SEQ ID NO: 3, 7, 8, or 13.
A nucleic acid sequence (e.g., a nucleic acid sequence optimized for human codon usage) encoding a natriuretic polypeptide described herein can be inserted into any appropriate AAV9 viral vector. For example, a nucleic acid sequence encoding a human CDNP can be inserted into an AAV9 vector having a nucleic acid sequence as set forth in GenBank® Accession No. AY530557 (GI No. 46487760), JA400113.1 (GI No. 346220229), JA232063 (GI No. 330731135), JA231827 (GI No. 330729561), or JA062576 (GI No. 328343515). In some cases, an AAV9 vector can have the sequence as described elsewhere. See, e.g., WO2003/052052, U.S. Patent Application Publication No. 20110236353, EP2345731, EP2292780, EP2292779, or EP2298926. In some cases, an AAV vector (e.g., AAV9 or AAV8 vectors) can be designed to express BNP, CNP, or CDNP as set forth in
In some cases, a promoter sequence can be operably linked to a nucleic acid sequence that encodes a natriuretic polypeptide (e.g., BNP, pre-proBNP, CDNP, B-CDNP, or C-CDNP) to drive expression of the natriuretic polypeptide. Examples of such promoter sequences include, without limitation, CMV, EFlalpha, BNP, CNP, ANP, MYH6 , and MYH7 promoters. In some cases, a promoter sequence that is active under conditions of elevated blood pressure with minimal, or no, activity under conditions of normal or low blood pressure can be operably linked to a nucleic acid sequence that encodes a natriuretic polypeptide (e.g., BNP, pre-proBNP, CDNP, B-CDNP, or C-CDNP) to drive expression of the natriuretic polypeptide under conditions of elevated blood pressure. Examples of such blood pressure sensitive promoter sequences include, without limitation, BNP and ANP promoters.
In one aspect, this document provides AAV9 vectors containing a nucleic acid sequence that encodes a natriuretic polypeptide. Such AAV9 vectors can infect cardiac cells and direct the expression of the natriuretic polypeptide by the infected cells.
Any appropriate method can be used to insert nucleic acid (e.g., nucleic acid encoding a natriuretic polypeptide) into the genome of an AAV9 vector. For example, standard molecule biology techniques such as restriction enzyme cutting, ligations, and homologous recombination can be used to insert nucleic acid into the genome of an AAV9 vector. Any appropriate method can be used to identify AAV9 vectors containing a nucleic acid molecule that encodes a natriuretic polypeptide. Such methods include, without limitation, PCR and nucleic acid hybridization techniques such as Northern and Southern analysis. In some cases, immunohistochemistry and biochemical techniques can be used to determine if an AAV9 vector contains a particular nucleic acid molecule by detecting the expression of a polypeptide encoded by that particular nucleic acid molecule.
In another aspect, this document provides nucleic acid molecules that encode a natriuretic polypeptide. For example, a nucleic acid molecule provided herein can be a single nucleic acid molecule that encodes the N-terminal region of a natural natriuretic polypeptide that includes one or more non-active components of an active natriuretic polypeptide such as a signal peptide sequence and other sequences that can be involved in polypeptide processing, folding, and stabilization upstream of an active component of a natriuretic polypeptide. In some cases, such a nucleic acid molecule can have a nucleic acid sequence that encodes a natriuretic polypeptide set forth in SEQ ID NO: 3, 7, 8, or 13.
In some cases, a nucleic acid molecule provided herein can include a promoter sequence operably linked to the nucleic acid sequence encoding a natriuretic polypeptide. For example, a nucleic acid molecule provided herein can include a promoter sequence that is active under conditions of elevated blood pressure operably linked to a nucleic acid sequence encoding a natriuretic polypeptide (e.g., CDNP).
The term “nucleic acid” as used herein encompasses both RNA and DNA, including cDNA, genomic DNA, and synthetic (e.g., chemically synthesized) DNA. A nucleic acid can be double-stranded or single-stranded. A single-stranded nucleic acid can be the sense strand or the antisense strand. In addition, a nucleic acid can be circular or linear.
This document also provides methods for treating cardiovascular and/or renal diseases (e.g., to reduce blood pressure, cardiomyocyte hypertrophy, cardiac fibrosis, or renal fibrosis, or to improve systolic and diastolic dysfunctions). For example, an AAV9 vector provided herein can be administered to a mammal having a cardiovascular and/or renal disease to reduce blood pressure within the mammal. An AAV9 vector provided herein can be produced in human cell lines, such as 293T cells, or other types of cells such as insect cells, which can be concentrated typically by at least 100-fold, or even by as much as 5,000- to 10,000-fold, through ultracentrifugation. A viral titer typically is assayed by measuring the viral vector copy numbers in concentrated/purified vector preparations.
An AAV9 vector provided herein can be administered to a patient (e.g., human patient) by, for example, direct injection into a group of cardiac cells or intravenous delivery to cardiac cells. An AAV9 vector provided herein can be administered to a patient in a biologically compatible solution or a pharmaceutically acceptable delivery vehicle such as saline, by administration either directly into a group of cardiac cells or systemically (e.g., intravenously). Suitable pharmaceutical formulations depend in part upon the use and the route of entry. Such forms should not prevent the composition or formulation from reaching a target cell (i.e., a cell to which the virus is desired to be delivered to) or from exerting its effect. For example, pharmacological compositions injected into the blood stream should be soluble.
While dosages administered will vary from patient to patient, an effective dose can be determined by setting as a lower limit the concentration of virus proven to be safe and escalating to higher doses of up to 1013 vector genome copies (vg)/kg, while monitoring for a response (e.g., a reduction in blood pressure) along with the presence of any deleterious side effects. Escalating dose studies can be used to obtain a desired effect for a given viral treatment.
An AAV9 vector provided herein can be delivered in a dose ranging from, for example, about 103 vg/kg to about 1013 vg/kg. A therapeutically effective dose can be provided in repeated doses. Repeat dosing is appropriate in cases in which observations of clinical symptoms or monitoring assays indicate that the degree of viral activity (e.g., natriuretic polypeptide expression) is declining. Repeat doses can be administered by the same route as initially used or by another route. A therapeutically effective dose can be delivered in several discrete doses (e.g., days, weeks, months, or years apart).
An AAV9 vector provided herein can be directly administered to cardiac cells. For example, a virus can be injected directly into heart tissue. In some cases, ultrasound guidance can be used in such a method. In some cases, an AAV9 vector provided herein can be delivered systemically. For example, systemic delivery can be achieved intravenously via injection. The course of therapy with an AAV9 vector provided herein can be monitored by evaluating changes in clinical symptoms.
The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
EXAMPLES Example 1 Long-Term Cardiac proBNP Gene Delivery Prevents the Development of Hypertensive Heart Disease in Spontaneously Hypertensive Rats SHR and Wistar ratsFour week-old SHR and five week-old Wistar rats were purchased from Charles River. SHR served as a model of progressive HHD. Strains of rats, number of animals, treatment, and duration of treatment in each experiment was summarized in Table 1. All animal studies were approved by the Institutional Animal Care and Use Committee.
HEK 293T cells were maintained in Dulbecco's modified Eagle's medium supplemented with 10% calf serum, 50 U/mL penicillin, and 50 μg/mL streptomycin. A murine atrial cardiomyocyte cell line, HL-11, was obtained from Dr. William C. Claycomb (Louisiana State University Medical Center, New Orleans) and cultured in Claycomb's medium with 10% FBS, 100 μM norepinephrine, and 4 mM L-glutamine on 0.02% gelatin/fibronectin-coated flasks or plates.
Transfection, Immunoblotting and ImmunostainingFugene6 (Roche) was used for transfection. For immunoblotting, immuno-reactive rat BNPs were detected using rabbit anti-rat BNP1-45 antibody (AssayPro) and HRP-conjugated anti-rabbit IgG antibody. Immunostaining of immuno-reactive rat BNP was performed using the same anti-rat BNP1-45 antibody and FITC-conjugated anti-rabbit IgG antibody.
IVIS ImagingThe cardiac luciferase expression was monitored by Xenogen IVIS biophotonic imaging machine. Upon luciferin administration through IP, anesthetized rats were euthanized, and the organs were harvested immediately. Harvested tissues were placed on the 10-cm plates on the imaging chamber, and a background photo of the tissues and a color overlay of the emitted photon data were obtained.
Toxicological and Pharmacological TestsFor toxicological and pharmacological tests, hematological parameters (VetScan HM2 Hematology System; 504 blood in EDTA for WBC counts, WBC histogram, Hb, Hct, MCV, MCH, MCHC, RDW, graphic RBC histogram, PLT count, MPV, PCT, PDW and Graphic platelet histogram) and chemistry (VetScan Classic; 1004 blood in lithium heparin; ALB, ALP, ALT, AMY, BUN, CA++, CRE, GLOB, GLU, K+, Na+, PHOS, TBIL, TP) were measured.
PlasmidsThe codon-optimized rat pre-proBNP was synthesized by GenScript, and cloned into a lentiviral vector, pSIN-CSGWdlNotI. The BamHI-XhoI short fragment, which contained rat pre-proBNP and WPRE post-transcriptional regulatory element, was then cloned into the mammalian expression plasmid, pAAV-MCS (Stratagene), resulting in pAAV-rat-pre-proBNP.
AAV9 and AAV2 VectorsThe AAV9 vector stocks were produced in human 293T cells using the helper-free transfection method according to the manufacturer's protocol (Stratagene). For AAV9 vector production, AAV9 capsid-expressing plasmid pRep2Cap9 (obtained from Dr. Hiroyuki Nakai) was used, while AAV2 vector was made with the AAV2 capsid-expressing plasmid, pAAV-RC (Stratagene). Firefly luciferase-, humanized recombinant green fluorescent protein (GFP)-, or rat proBNP-encoding AAV genome constructs were packaged. Three days after transfection, AAV9 vector-producing 293T cells were harvested for vector purification. The cells were lysed by freeze and thaw cycling, followed by ultracentrifuge concentration (62,500 rpm for 2 hours) through Optiprep Density Gradient Medium (Sigma). The resulting AAV9 vectors were desalted and further concentrated using Amicon Ultra-15 100k filtration (Amicon). The titers (genomic copy numbers/mL) of concentrated AAV9 vector stocks were determined by quantitative PCR using plasmid DNA standards, AAV genomic sequence-specific primers, and a fluorescent probe.
Non-Invasive Tail Blood Pressure MeasurementThe blood pressure (BP) of conscious rats was measured by the CODA High-Throughput Non-Invasive Tail BP System (Kent Scientific).
Echocardiography (ECHO) for Non-Invasive Assessment of Ventricular Function and StructureTo evaluate cardiac function and structure, both standard ECHO and Two-Dimensional Speckle-Derived Strain ECHO (2DSE) examinations were performed at four and nine months post injections in the BNP-treated and the untreated SHR. Standard ECHO and 2DSE also were performed in normal Wistar rats at 4 weeks after AAV9 injections. All ECHO examinations were performed by a skilled sonographer blinded to the treatment.
Standard ECHO was performed as follows. After removing chest hair, ultrasonic scans was performed in all rats in supine position using a Vivid 7 system (GE Healthcare, Milwaukee, Wis.) equipped with a 10S ultrasound probe (11.5 MHz) with ECG monitoring. M-mode images and gray scale 2D images (300-350 frames/sec) of the parasternal long-axis and mid-LV was recorded for off-line analysis. LV end-diastolic (LVDd) and end-systolic (LVDs) dimensions and septal diastolic (SWTd) and posterior wall diastolic (PWTd) and systolic (PWTs) thicknesses were measured from M-mode images. LV mass was calculated according to uncorrected cube assumptions as LV mass=1.055×[(LVDd+SWTd+PWTd)3-(LVDd)3], where 1.055 is the specific gravity of myocardium. LV mass was corrected for body weight (LVMi) for analysis. End-systolic (ESV), end-diastolic and stroke volumes (SV), and ejection fraction (EF) was calculated using the Teichholz formula: LV volume=7×[(LVDd)3/(2.4+LVDd)]. Relative wall thickness (RWT) was calculated as RWT=(SWTd+PWTd)/LVDd. All parameters represented the average of three beats.
2DSE was performed as follows. Using EchoPAC software (EchoPAC PC-2D strain, BTO 6.0.0, GE Healthcare, Milwaukee, Wis.), which included a high resolution speckle tracking analysis library for off-line analysis, endocardial border was carefully manually traced at end-systole in LV short-axis views at the middle level (i.e., at the level of papillary muscles). Ideal width of circular region of interest was chosen in order to include the entire myocardial wall. Speckle tracking was performed by the software and global strain, and circumferential strain rate parameters were measured computing the mean of the six middle LV segments. The analysis included peak circumferential systolic strains (sS) and strain rates (sSR) for evaluation of myocardial systolic function and peak early circumferential strain rates (dSR-E) for evaluation of myocardial diastolic function. All parameters represented the average of three beats. Using standard ECHO and 2DSE, significant improvement were detected in both systolic and diastolic function in a rat model of cardiac dysfunction when compared to the untreated SHR.
Acute Experiment ProcedureRats for the acute protocol were anesthetized with isoflurane (1.5% in oxygen). Placement of PE-50 tubing into the carotid artery for BP monitoring and blood sampling were performed. A portion of the neck skin was removed, and the carotid artery were isolated and cleared. A cut was made with micro-scissors, and a PE-50 tubing was introduced into the vessel for direct BP monitoring. Blood was drawn to evaluate toxicological reactions in AAV9-BNP transduced rats and to measure BNP and cGMP. At the end of the experiments, rat organs were harvested for further analysis.
Masson's Trichrome StainingThe sections of frozen cardiac samples were assessed by Trichrome staining for collagen contents. Percent blue signals were analyzed by KS400 Image Analysis Software (version 3.0, Zeiss).
Sample Size and Statistical AnalysisGroups were compared by unpaired t-test, and changes within-groups were assessed by paired t-test. Comparisons of BP values between groups were performed by two-way ANOVA for repeated measurements. Data were expressed as mean±SD. Significance was accepted for p<0.05.
ResultsIn Vitro Expression and Localization of proBNP
After successfully engineering AAV9 encoding for the rat pre-proBNP, which included the signal peptide (SP), NT-proBNP, and BNP1-45 domains (
The rat pre-proBNP- or firefly luciferase-expressing vectors were packaged in AAV9 capsid, and the influence of AAV9 vector-mediated gene delivery was examined in SHR. Four week-old SHR (n=2) were used. Three weeks after tail intravenous injection of AAV9 carrying luciferase (1012 genome copy/animal), the tissue specificity of the AAV9 vector was determined by luciferase expression in the SHR, which demonstrated high levels of luciferase expression in myocardium (
Effects of Sustained proBNP Expression in SHR
The effects of sustained proBNP expression in SHR through cardiac proBNP delivery by AAV9 vector were monitored. Four months after AAV9-pre-proBNP injections in SHR, there was no toxicological reaction compared to untreated SHR. Importantly, plasma immune reactive BNP was significantly higher in the AAV9-pre-proBNP-treated group compared with the untreated SHR (
Echocardiographic parameters in untreated SHR and in AAV9 pre-proBNP treated SHR were summarized in Table 2. While no difference was detected in HR between AAV9 pre-proBNP treated and untreated SHR both at four and nine months post injection, echo analysis indicated a significant improvement of diastolic function at four and nine months as well as systolic function at nine months post injection in AAV9 pre-proBNP treated SHR as compared with untreated SHR (
At nine months post-injection, four rats per group were sacrificed for acute experiments. Direct intra-carotid systolic and diastolic blood pressure was reduced in the AAV9 pre-proBNP treated anesthetized SHR (
The effects of non-cardiac proBNP gene delivery on BP, plasma BNP levels, and heart weight in SHR were assessed. For non-cardiac gene delivery, conventional AAV2 vectors were administered through intra-peritoneal injection. One month after administration of AAV2 vector carrying luciferase, high levels of luciferase expression were found in peritoneum, but not in heart (
Effects of Sustained proBNP Expression in Normotensive Rats
To investigate whether the beneficial effects on both cardiac structure and function observed in the BNP-treated SHR were mainly due to the sustained BP effects, AAV9 encoding for GFP or pre-proBNP was injected in normal Wistar rats (n=12). Six rats per group underwent echocardiographic examination 4 weeks after injections and were sacrificed for acute experiments thereafter. Normal rats treated with AAV9 carrying GFP (n=6) showed wide spread GFP expression in cardiomyocytes 4 weeks after injection, further confirming the cardiac transduction of the AAV9 vector (
These results demonstrate successful in vivo cardiomyocyte transduction via a AAV9 vector that facilitated sustained cardiac proBNP overexpression. Long-term proBNP delivery led to reduced BP and improved LV function and structure in an HHD rat model without any short- or long-term toxicological adverse effects or development of tolerance. Although long-term proBNP delivery improved both systolic and diastolic function, the effect on diastolic performance was more remarkable and preceded the improvement in systolic function in this HHD model. Importantly, the effects on cardiac structure and function occurred independently of BP lowering effects in normal Wistar rats.
These results also demonstrated that rat BNP is released from pre-proBNP-expressing 293T cells as a HMW form.
In addition, rat proBNP overexpression was associated with significant and sustained BP reduction in SHR. Indeed, SBP, DBP and MAP were lower in the BNP-treated as compared with the control SHR from two months up to nine months post-AAV9 injection. This reduction of BP was rather modest and occurred without changes in HR. Of note, BP was reduced at the vector dose used in the current study, while it did not completely normalized BP, which remained elevated throughout the period of observation. It is possible that a higher vector dose would result in a more profound BP reduction. Although the use of telemetry would have helped in better assessing BP changes, a significant BP lowering effect of BNP was confirmed in unconscious BNP-treated SHR compared to the untreated SHR via direct intra-arterial BP measurements at the time of the acute experiments (9 months).
Plasma immunoreactive rat BNP45 was elevated in the BNP-treated as compared with the control SHR at four days, three weeks, and four and nine months post-injection, confirming a sustained overexpression of BNP in the heart. At nine months post-injection, plasma cGMP was not different between the BNP-treated and the control SHR. In contrast, urinary cGMP was increased in the BNP-treated as compared with the control SHR. Thus, the lack of elevation of plasma cGMP may be explained by the increased urinary cGMP excretion.
Chronic overexpression of proBNP prevented the development of HHD, which began at four weeks of age in the SHR. Indeed, AAV9 induced proBNP production resulted in a sustained and significant reduction (up to nine months) of SBP and DBP. Thorough echo analysis demonstrated a significant improvement of diastolic function at four months post transfection in the BNP-treated group as compared with the untreated SHR. Importantly, at nine months, untreated SHR also developed signs of impaired systolic function which was prevented in the BNP-treated SHR. Of note, global cardiac function and remodeling were not only improved in the BNP-treated SHR compared to untreated SHR of the same age but also, BNP-treated SHR at nine months showed improved diastolic function and reduced cardiac hypertrophy even when compared with the untreated SHR at four months of age. This finding further supports the beneficial role of BNP in preventing cardiac dysfunction and remodeling. Of note, all these favorable actions occurred without signs of any short- or long-term toxicological side effects and BNP maintained its biological actions up to nine months post injection without developing tolerance. It should be noted that, although sustained, the BP reduction was minimal, thus further studies are required to address the pathogenic role of BNP in hypertension.
In SHR transduced with non-cardiac AAV2 vector, no increase in plasma immunoreactive BNP was observed. This could be due to a less efficient intracellular processing and/or release of rat BNP in non-cardiac cells. Furthermore, in these AAV2-transduced SHR, changes in heart weight compared to untreated controls were not observed. The work described herein used a comparable vector dose for both the AAV2 and AAV9 studies.
The work was extended to normal rats to investigate the anti-hypertrophic actions of BNP overexpression in the absence of hypertension. In this model, age induced systolic impairment was significantly ameliorated in the BNP-treated rats by echo strain analysis at 4 weeks. Also, cardiac mass was reduced in the BNP-treated rats as compared with the controls and heart weight/body weight was significantly lower in the BNP-treated rats as compare to the controls. Importantly, the improved cardiac function and the reduced cardiac mass were observed after 4 weeks post injections of the AAV9 vector and occurred despite any difference in BP (measured directly intra-carotid) between the BNP-treated and the control group.
Taken together, the results provided herein demonstrate that the use of chronic supplementation of the cardiorenal protective hormone BNP can be employed in hypertension to prevent the progression toward more severe stages of HHD and the onset of heart and renal failure. Instead of oral delivery, a gene transfection strategy was used to facilitate a nine month delivery of bioactive BNP with single intravenous injection of the AAV9 vector. As indicated herein, chronic overexpression of BNP in SHR reduced BP, decreased LVH, tended to reduce fibrosis, and improved systolic and diastolic function.
In summary, the results provided herein demonstrate the successful cardiac delivery of the AAV9 vector, which mediated sustained cardiac proBNP overexpression without any short- or long-term toxicological effects and any signs of tolerance. Importantly, sustained cardiac BNP overexpression reduced BP and improved LV function in a model of progressive HHD after a single intravenous injection. Although long-term proBNP delivery improved both systolic and diastolic function, the effect on diastolic performance was more remarkable and appeared earlier during the development of HHD. Ultimately, sustained overexpression of BNP in SHR prevented the development of HHD as nine month old BNP-treated SHR had a significantly improved cardiac function and structure even when compared with four month old untreated SHR. Non-cardiac BNP-overexpression was not associated with increase in plasma BNP, changes in BP, and reduced heart weight. The direct cardiac effects of overexpressed BNP seem to be, at least in part, independent of BP lowering action as indicated by the improved systolic function and reduced heart weight in the normotensives rats despite no changes in BP.
In addition, an AAV9 vector designed to express luciferase achieved long-term cardiac luciferase expression in SHR rats at least for 18 months (
To deliver rat BNP-45 to rat cardiac cells, a cardio-tropic AAV9 vector was designed to express a rat proBNP polypeptide having a rat N-terminus proBNP amino acid sequence (called an NT-proBNP region) upstream of a rat BNP-45 amino acid sequence. The amino acid sequence for the rat NT-proBNP region with its signal peptide of the rat proBNP polypeptide was MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLR (SEQ ID NO:1). The amino acid sequence for the rat BNP-45 of the rat proBNP polypeptide was SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (SEQ ID NO:2). The amino acid sequence for the rat pre-proBNP polypeptide was MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPT KELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (SEQ ID NO:3).
To deliver CDNP to rat cardiac cells, two cardio-tropic AAV9 vectors were designed. One AAV9 vector was designed to express a polypeptide designated B-CDNP, and the other AAV9 vector was designed to express a polypeptide designated C-CDNP. The B-CDNP polypeptide included a human N-terminus proBNP amino acid sequence (called an NT-proBNP region) upstream of the CDNP amino acid sequence, while the C-CDNP polypeptide included a human N-terminus proCNP amino acid sequence (called an NT-proCNP region) with its signal peptide upstream of the CDNP amino acid sequence. The amino acid sequence for human NT-proBNP region with its signal peptide of the B-CDNP polypeptide was with its signal peptide MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRP TGVWKSREVATEGIRGHRKMVLYTLRAPR (SEQ ID NO:4), and the amino acid sequence for the rat NT-proCNP region with its signal peptide of the C-CDNP polypeptide was MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGGKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLGEHPNAR KYKGANKK (SEQ ID NO:5). The amino acid sequence for CDNP of the B-CDNP and C-CDNP polypeptides was GLSKGCFGLKLDRIGSMSGLGCPSLRDPRPNAPSTSA (SEQ ID NO:6). The amino acid sequence for B-CDNP polypeptide was MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSL EPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRGLSKGCFGLKLDRIGSM SGLGCPSLRDPRPNAPSTSA (SEQ ID NO:7), and the amino acid sequence for C-CDNP polypeptide was MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQ EHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGCPSLRDPRPNAPSTSA (SEQ ID NO:8).
The nucleic acid sequences encoding B-CDNP and C-CDNP were codon-optimized for expression in human cells. The nucleic acid sequence encoding B-CDNP was as follows 5′-ATGGACCCACAGACAGCTCCCAGTAGGGCTTTGCTTCTTTTGCTTTTCCTGCACCTGGCTTTTCTGGGCGGACGATCCCATCCACTGGGTAG CCCTGGCTCCGCCTCAGATCTGGAGACTAGTGGACTGCAGGAGCAGCGCAAT CACTTGCAGGGCAAACTGTCCGAGCTGCAGGTGGAACAAACGAGCCTCGAGC CCCTGCAGGAGAGCCCTAGACCTACCGGGGTGTGGAAGTCTCGAGAGGTAGC GACAGAAGGCATTAGAGGGCACAGGAAGATGGTACTGTATACTCTGAGGGCC CCAAGGGGACTGAGCAAGGGCTGTTTTGGCCTGAAGCTGGATCGGATTGGCA GCATGTCCGGCCTGGGCTGCCCTTCCCTGCGGGACCCACGGCCAAATGCCCCC TCCACCAGCGCCTAA-3′ (SEQ ID NO:9), while the nucleic acid sequence encoding C-CDNP was as follows 5′-ATGCATCTGTCCCAACTGCTGGCTTGTGCTCTCCTGCTGACTCTGCTGAGCCTCCGGCCTAGCGAGGCCAAGCCTGGAGCACCACC TAAGGTCCCCAGGACTCCTCCAGCCGAAGAACTGGCTGAGCCTCAGGCTGCC GGGGGCGGGCAGAAGAAAGGAGACAAAGCCCCTGGAGGGGGCGGGGCTAAT CTCAAGGGCGATAGGTCCAGACTGCTGAGGGATCTGAGAGTGGACACAAAGT CCAGGGCCGCCTGGGCACGGCTCCTGCAAGAGCACCCTAACGCTCGGAAGTA CAAAGGGGCCAATAAGAAGGGCCTCAGCAAAGGCTGCTTTGGCCTGAAACTG GACAGAATTGGCTCCATGTCCGGCCTCGGCTGCCCTTCCCTGCGGGACCCTCG GCCCAATGCCCCTTCCACTAGCGCTTAA-3′ (SEQ ID NO:10).
Spontaneously hypertensive rats (SHR) were divided into groups of six rats each. One group included rats that were untreated, while the other groups were treated with a single intravenous injection of AAV9 vectors designed to express the rat proBNP polypeptide, the B-CDNP polypeptide, or the C-CDNP polypeptide. After five weeks, the rats were examined to determine the weights of their hearts, lungs, and kidneys. No significant difference was detected for the lungs and kidneys between the treated and untreated animals (
These results demonstrate that a single intravenous administration of a natriuretic polypeptide-carrying AAV9 vector can protect the heart from excessive fibrosis and hypertrophy in mammals with hypertension and/or with renal dysfunction. These results also demonstrate that the methods and materials provided herein can be used for long-term natriuretic polypeptide treatment (e.g., long-term CNDP treatment) of patients with cardiovascular and/or renal diseases (e.g., those patients with severe cardiac hypertrophy and dysfunction).
In another set of experiments, an AAV9 vector designed to express BNP was used to mediate cardiac BNP expression and extend the survival of rats with established hypertensive heart disease (
Treated and untreated rats were monitored for survival. AAV9 vector-mediated cardiac BNP expression extended the survival of rats with established hypertensive heart disease (
Sustained cardiac proBNP over-expression by the AAV9 vector improved cardiac function and structure in established hypertensive heart disease (
Expression of proBNP using an AAV9 vector designed to express proBNP resulted in improved cardiac functions in a rat model of polycystic kidney disease (
To deliver human BNP to human cardiac cells, a cardio-tropic AAV9 vector was designed to express a human proBNP polypeptide having a human N-terminus proBNP amino acid sequence (called an NT-proBNP region) upstream of a human BNP-32 amino acid sequence. The amino acid sequence for the signal peptide and NT-proBNP region of the human proBNP polypeptide was MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATE GIRGHRKMVLYTLRAPR (SEQ ID NO:4). The amino acid sequence for the human BNP-32 of the human proBNP polypeptide was SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (SEQ ID NO:11). The amino acid sequence for the human proBNP polypeptide was MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIR GHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (SEQ ID NO:12).
To deliver CDNP to human cardiac cells, two cardio-tropic AAV9 vectors were designed. One AAV9 vector was designed to express a polypeptide designated human B-CDNP, and the other AAV9 vector was designed to express a polypeptide designated human C-CDNP. The human B-CDNP polypeptide was designed to include a human N-terminus proBNP amino acid sequence (called an NT-proBNP region) upstream of the CDNP amino acid sequence, while the C-CDNP polypeptide was designed to include a human N-terminus proCNP amino acid sequence (called an NT-proCNP region) upstream of the CDNP amino acid sequence. The amino acid sequence for the human NT-proBNP region with signal peptide of the human B-CDNP polypeptide was MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEP LQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR (SEQ ID NO:4), and the amino acid sequence for the human NT-proCNP region of the human C-CDNP polypeptide was MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGGKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLG EHPNARKYKGANKK (SEQ ID NO:5). The amino acid sequence for CDNP of the human B-CDNP and human C-CDNP polypeptides was GLSKGCFGLKLDRIGSMSGLGCPSLRDPRPNAPSTSA (SEQ ID NO:6). The amino acid sequence for human B-CDNP polypeptide was MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEG IRGHRKMVLYTLRAPRGLSKGCFGLKLDRIGSMSGLGCPSLRDPRPNAPSTSA (SEQ ID NO:7), and the amino acid sequence for human C-CDNP polypeptide was MHL SQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDK APGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLS KGCFGLKLDRIGSMSGLGCPSLRDPRPNAPSTSA (SEQ ID NO:8).
The nucleic acid sequences encoding human B-CDNP and human C-CDNP were codon-optimized for expression in human cells. The nucleic acid sequence encoding human B-CDNP was as follows 5′-ATGGACCCACAGACAGCTCCCAGTAGGGCTTTGCTTCTTTTGCTTTTCCTGCACCTGGCTTTTCTGGGCGGACGATCCCATC
CACTGGGTAGCCCTGGCTCCGCCTCAGATCTGGAGACTAGTGGACTGCAGGA GCAGCGCAATCACTTGCAGGGCAAACTGTCCGAGCTGCAGGTGGAACAAACG AGCCTCGAGCCCCTGCAGGAGAGCCCTAGACCTACCGGGGTGTGGAAGTCTC GAGAGGTAGCGACAGAAGGCATTAGAGGGCACAGGAAGATGGTACTGTATA CTCTGAGGGCCCCAAGGGGACTGAGCAAGGGCTGTTTTGGCCTGAAGCTGGA
TCGGATTGGCAGCATGTCCGGCCTGGGCTGCCCTTCCCTGCGGGACCCACGGC CAAATGCCCCCTCCACCAGCGCCTAA-3′ (SEQ ID NO:9), while the nucleic acid sequence encoding human C-CDNP was as follows 5′-ATGCATCTGTCCCAACTGCTGGCTTGTGCTCTCCTGCTGACTCTGCTGAGCCTCCGGCCTAGCGAGGC CAAGCCTGGAGCACCACCTAAGGTCCCCAGGACTCCTCCAGCCGAAGAACTG
GCTGAGCCTCAGGCTGCCGGGGGCGGGCAGAAGAAAGGAGACAAAGCCCCT GGAGGGGGCGGGGCTAATCTCAAGGGCGATAGGTCCAGACTGCTGAGGGATC TGAGAGTGGACACAAAGTCCAGGGCCGCCTGGGCACGGCTCCTGCAAGAGCA CCCTAACGCTCGGAAGTACAAAGGGGCCAATAAGAAGGGCCTCAGCAAAGG CTGCTTTGGCCTGAAACTGGACAGAATTGGCTCCATGTCCGGCCTCGGCTGCC CTTCCCTGCGGGACCCTCGGCCCAATGCCCCTTCCACTAGCGCTTAA-3′ (SEQ ID NO:10).
OTHER EMBODIMENTSIt is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
Claims
1. An AAV9 vector comprising a nucleic acid sequence encoding a natriuretic polypeptide.
Type: Application
Filed: Sep 6, 2018
Publication Date: Dec 27, 2018
Applicant: Mayo Foundation for Medical Education and Research (Rochester, MN)
Inventors: Yasuhiro Ikeda (Rochester, MN), Stephen James Russell (Rochester, MN), Alessandro Cataliotti (Rochester, MN), John C. Burnett, Jr. (Rochester, MN), Jason M. Tonne (Rochester, MN)
Application Number: 16/123,010