Abstract: The invention relates to compounds and methods for targeting radionuclide-based imaging agents to cells having receptors for a vitamin, or vitamin receptor binding derivative or analog thereof, by using such a vitamin as the targeting ligand for the imaging agent. The invention provides a compound of the formula for use in such methods. In the compound, V is a vitamin that is a substrate for receptor-mediated transmembrane transport in vivo, or a vitamin receptor binding derivative or analog thereof, L is a divalent linker, R is a side chain of an amino acid of the formula H2NCHRCOOH, M is a cation of a radionuclide, n is 1 or 0, K is 1 or 0, and the compound can be in a pharmaceutically acceptable carrier therefor. The vitamin-based compounds can be used to target radionuclides to cells, such as a variety of tumor cell types, for use in diagnostic imaging of the targeted cells.

Abstract: The present invention relates to fluorescent or luminescent probe reagents for measuring oxidative stress in a cell or an organism. Examples of the probe reagents include: a fluorescent or luminescent protein and a marker protein; a fluorescent or luminescent protein, a marker protein, and a regulatory factor; or a fluorescent or luminescent protein, a marker protein, a cleavage sequence, and a regulatory factor. In the probe reagents, the marker protein makes it possible to detect the oxidative stress caused by reactive oxygen species and comprises a regulatory factor-binding site and a ubiquitin-binding site; and the regulatory factor is a protein making it possible to regulate degradation of the marker protein in response to the reactive oxygen species. The present invention also relates to a method of measuring oxidative stress in a cell or an organism, or a method of screening a substance which suppresses or promotes the oxidative stress in a cell or an organism by using the probe reagent.

Abstract: The present invention provides a novel method of labelling biological targeting molecules (BTMs) of interest with radioiodine. Also provided are novel radioiodinated BTMs prepared using the method, as well as radiopharmaceutical compositions comprising such radioiodinated BTMs. The invention also provides radioiodinated intermediates useful in the method, as well as in vivo imaging methods using.

Abstract: The present disclosure relates generally to novel methods and compositions for using engineered reprogramming factor(s) for the creation of induced pluripotent stem cells (iPSCs) through a kinetically controlled process. Specifically, this disclosure relates to establishing combinations of reprogramming factors, including fusions between conventional reprogramming factors with transactivation domains, optimized for reprogramming various types of cells. More specifically, the exemplary methods disclosed herein can be used for creating induced pluripotent stem cells from various mammalian cell types, including human fibroblasts. Exemplary methods of feeder-free derivation of human induced pluripotent stem cells using synthetic messenger RNA are also disclosed.

Abstract: The present invention provides polypeptides, peptide dimer, and multimeric complexes comprising at least one binding moiety for KDR or VEGF/KDR complex, which have a variety of uses wherever treating, detecting, isolating or localizing angiogenesis is advantageous. Particularly disclosed are synthetic, isolated polypeptides capable of binding KDR or VEGF/KDR complex with high affinity (e.g., having a KD<1 ?M), and dimer and multimeric constructs comprising these polypeptides.

Abstract: This invention relates, e.g., to a composition suitable for administration to the central nervous system (CNS), comprising a block copolypeptide hydrogel, which comprises a biologically active material that is mixed with the hydrogel or that is attached to the polypeptide chain of the hydrogel, wherein the composition is suitable for administration to the CNS. Also disclosed are methods of making and using compositions of the invention as depots or as scaffolds for cell migration, and pharmaceutical compositions and kits for implementing methods of the invention.

Abstract: Disclosed are peptides comprising a molecular scaffold portion and a loop portion that binds to integrin ?v?6. This integrin is expressed on pancreatic tumors, making the peptides useful as imaging agents, among other uses. The peptides showed single-digit nanomolar dissociation constants similar to antibodies used clinically for imaging and therapy. The peptides rapidly accumulated in ?v?6-positive tumors, which led to excellent tumor-to-normal contrast. The peptides are specific for the targeted integrin ?v?6 receptors expressed on orthotopic pancreatic tumors and various xenografts used. Additionally, pharmacokinetic-stabilization strategies endowed knots with rapid renal clearance, which significantly reduced off-target dosing.

Abstract: The invention relates to methods of imaging asthma using ligand conjugates. More particularly, the invention relates to the use of ligands that bind to cells associated with asthma conjugated to a chromophore, or to a chemical moiety capable of emitting radiation, for administration to a diseased host for imaging asthma.

Abstract: Embodiments of the present disclosure provide for labeled probes such as a 64Cu-FN3 probe (FN3 refers to fibronectin type 3 domain); methods of making labeled probes; pharmaceutical compositions including labeled probes; methods of using labeled probes; methods of diagnosing, localizing, monitoring, and/or assessing non-Hodgkin's lymphoma, cancers, tumors, precancerous cells, and related biological events using labeled probes; kits for diagnosing, localizing, monitoring, and/or assessing non-Hodgkin's lymphoma, cancers, tumors, precancerous cells, and related biological events; and the like.

Abstract: The present invention relates to a method useful in facilitating the identification of fibrogenesis in a subject. The method of the invention is particularly useful when applied as part of a method to diagnose fibrogenesis of the liver. The invention also provides a compound for use in a method for identification of fibrogenesis in a subject A further aspect of the invention is a compound for use in the preparation of a medicament for use in a method for identification of fibrogenesis in a subject.

Abstract: The invention relates to compounds and methods for targeting radionuclide-based imaging agents to cells having receptors for a vitamin, or vitamin receptor binding derivative or analog thereof, by using such a vitamin as the targeting ligand for the imaging agent. The vitamin-based compounds can be used to target radionuclides to cells, such as a variety of tumor cell types, for use in diagnostic imaging of the targeted cells.

Abstract: A radiotherapy method, comprising positioning a predetermined amount of a radionuclide selected from the group consisting of Radium-223, Radium-224, Radon-219 and Radon-220, in proximity to and/or within a tumor of a subject, for a predetermined time period. The predetermined amount and the predetermined time period are selected sufficient for the radionuclide to administering a predetermined therapeutic dose of decay chain nuclei and alpha particles into the tumor.

Abstract: Cancer-targeting peptides and uses thereof in cancer diagnosis.

Abstract: Compositions and/or mixtures comprising peptide amphiphile compounds comprising one or more contrast agents, as can be used in a range of magnetic resonance imaging applications.

Abstract: The invention provides SPARC and Albumin binding peptides for the targeting of disease sites, such as tumors, with therapeutic and diagnostic agents. In particular, compositions comprising SPARC binding peptide-Antibody Fc domain fusion proteins and methods of their use are disclosed.

Abstract: The invention provides a conjugate of a biologically active molecule and a 5-fluoro-5-deoxypentose or a 3-fluoro-3-deoxypentose, wherein the biologically active molecule is selected from the group consisting of proteins, peptides, nucleic acids, oligosaccharides and polysaccharides.

Abstract: A method is provided for determining in real time the course of thrombin activity in a sample of blood or plasma as it appears in and disappears from the simple which comprises adding a thrombin substrate to the sample that, per unit time, produces a detectable signal in a quantity that bears relation to the amount of thrombin present. Simultaneously, in a control sample of the same blood or plasma in which thrombin generation is not triggered, the activity of a standard preparation with invariable thrombin activity is measured. The exact molar amount of thrombin present at any moment is obtained by comparison of the activity measured in clotting blood and the simultaneously measured calibrator. The method is useful inter alia for diagnosing hyper- and hypo-coaguable states, either congenital, acquired or drug-induced in humans and animals. Also provided is a kit for use in this method.

Abstract: Prostaglandin-F2 alpha (PGF2?) receptor (FP) modulators of formula I, as well as the use of PGF2? receptor modulators for the treatment of conditions associated with FP activity such as preterm labor and colorectal cancer, are disclosed.

Abstract: The present invention relates to the use of receptor-associate protein (RAP) and fragments and variants thereof to improve delivery of therapeutic compounds to the liver and provides methods to treat liver disorders and conditions, such as hepatic carcinoma, by administering RAP or RAP variants conjugated to active agents.

Abstract: Methods of imaging a living host using Raman nanoparticles; methods of generating a true image of a living host having been administered Raman nanoparticles; methods of multiplex imaging of a living host using a plurality of Raman nanoparticles; methods of generating multimodality images by combining Raman images with other functional/anatomical images; labeled Raman nanoparticles; and the like, are provided.

Abstract: Compositions, articles, and methods for treating and imaging vulnerable plaque and other inflamed regions in a patient rely on delivery of a conversion electron emitting source (CEES) to a body location. The CEES may be delivered by coupling to a substance which preferentially binds to vulnerable plaque or other inflammatory marker. Alternatively, the CEES can be delivered on a catheter, scaffold, or other device.

Abstract: The various embodiments herein provide hydrogel nanocomposite wound dressing comprising a polymeric basal matrix, a reinforcing agent, a biological sensor and an antibiotic for a slow release in a wound when applied. The polymeric basal matrix is made up of polyvinyl alcohol polymer with an amount of 1-15% by weight. The reinforcing agent comprises clay nanoparticles to inhibit a sudden drug release. The clay nanoparticles comprise montmorillonite nano particles with an amount of 0-2% by weight. The biological sensor is a peptide chain. The peptide chain is thrombin sensitive with an amount from 50 to 200 mg. The antibiotic is gentamycine with an amount of 1-3% by weight. The embodiments herein also provide a method of synthesizing the hydrogel nanocomposite wound dressing.

Abstract: The present invention provides compositions comprising at least one GHB moiety bonded to at least one physiologically compatible carrier molecule. The compositions can enhance the uptake of the drug, deliver effective therapeutic doses in a time-delayed fashion, or can target specific organs.

Abstract: The invention provides compositions and method for delivering a therapeutic or diagnostic agent to a disease site in a mammal, the method comprising administering to the mammal a therapeutically or diagnostically effective amount of a pharmaceutical composition, wherein the pharmaceutical composition comprises the therapeutic or diagnostic agent coupled to a Procaspase 8 polypeptide and a pharmaceutically acceptable carrier.

Abstract: The invention encompasses radiopharmaceutical compounds that can be used in imaging cell death associated with either apoptosis or necrosis. Phosphatidylethanolamine (PtdE) is externalized to the surface of apoptotic cells, and also becomes accessible in necrotic cells due to compromised plasma membrane integrity. Duramycin, a 19 amino acid polypeptide, binds PtdE at a 1:1 ratio with high affinity and exclusive specificity. Novel Duramycin-based radiopharmaceuticals and non-radioactively labeled compounds are disclosed herein. Such compounds facilitate detection of cell apoptosis and/or necrosis by binding to PtdE. The location of the bound compound can then be pinpointed using standard imaging techniques.

Abstract: A chlorotoxin conjugate detectable by fluorescence imaging that allows for intra-operative visualization of cancerous tissues, compositions that include the chlorotoxin conjugate, and methods for using the chlorotoxin conjugate.

Abstract: The present invention provides methods and compositions for treatment, screening, diagnosis and prognosis of acute myeloid leukemia (AML), B-cell chronic lymphocytic leukemia, breast cancer, colorectal cancer, kidney cancer, head and neck cancer, lung cancer, ovarian cancer or pancreatic cancer, for monitoring the effectiveness of acute myeloid leukemia (AML), B-cell chronic lymphocytic leukemia, breast cancer, colorectal cancer, kidney cancer, head and neck cancer, lung cancer, ovarian cancer or pancreatic cancer treatment, and for drug development. The present invention also provides methods and compositions for depletion of immune cells to treat inflammatory diseases.

Abstract: Various embodiments of this invention relate generally to targeted activation and delivery of therapeutic drugs to cells that produce prostate specific antigen (PSA), prostate specific membrane antigen (PSMA) or human glandular kallikrein (hK2). Various further embodiments relate more specifically to PSMA-specific peptide prodrugs that become activated to yield therapeutic drugs. Further aspects of various embodiments of the present invention also relate to methods and compositions for treating or preventing cancers and methods and compositions for detecting and/or imaging cancers.

Abstract: The invention relates to the use of a cell death marker labelled with a wavelength-optimised label for identifying cell death in the eye. Suitable cell death markers are the Annexins and fragments and derivatives thereof. The invention also relates to a pharmaceutical composition comprising a cell death marker labelled with a wavelength-optimised label and a method for monitoring cell death in the eye using a cell death marker labelled with a wavelength-optimised label.

Abstract: A method for identifying a molecule that binds an irradiated tumor in a subject and molecules identified thereby. In some embodiments, the method includes the steps of (a) exposing a tumor to ionizing radiation; (b) administering to a subject a library of diverse molecules; and (c) isolating from the tumor one or more molecules of the library of diverse molecules, whereby a molecule that binds an irradiated tumor is identified. Also provided are targeting ligands that bind an irradiated tumor and therapeutic and diagnostic methods that employ the disclosed targeting ligands.

Abstract: The invention relates to a method for diagnosing a kidney disease state. The method comprises the steps of administering to a patient a composition comprising a conjugate or complex of the general formula V-L-D where the group V comprises a vitamin receptor binding ligand that binds to kidney proximal tubule cells and the group D comprises a diagnostic marker, and diagnosing the kidney disease state. The invention also relates to a method for treating a kidney disease state. The method comprises the steps of administering to a patient suffering from the disease state an effective amount of a composition comprising a conjugate or complex of the general formula V-L-D where the group V comprises a vitamin receptor binding ligand that binds to kidney proximal tubule cells and the group D comprises an antigen, a cytotoxin, or a cell growth inhibitor, and eliminating the disease state.

Abstract: The present invention discloses a method for the enzyme-mediated, site-specific, in-vivo precipitation of a water soluble molecule in an animal. The enzyme is either unique to tumor cells, or is produced within a specific site (e.g., tumor) at concentrations that are higher than that in normal tissues. Alternatively, the enzyme is conjugated to a targeting moiety such as an antibody or a receptor-binding molecule.

Abstract: The present invention provides targeted nanoplex molecules which carry multimodality imaging reporters together with target enzyme inhibitors such as siRNAs and target prodrug enzymes, that are useful for theranostic imaging of cells and diseases, including, for example, various cancers, and including metastatic prostate cancer. The nanoplex molecules of the present invention provide a platform technology toward many cancer subtypes and alternative therapeutic targets. Downregulation of specific pathways using targeted enzyme inhibitors further provides unique opportunities to target cancer cells selectively while sparing normal tissue. The nanoplex molecule platform described herein has the ability to deliver multiple siRNA enzyme inhibitors. Methods of diagnosis and treatment of various diseases are also included.

Abstract: The present invention relates to a novel class of diagnostically or therapeutically effective compounds comprising novel aza-bicycloalkane based cyclic peptides, acting as a targeting moiety towards integrin receptors.

Abstract: This invention relates to polypeptides which bind to EGFR family receptors and to applications of those polypeptides in medicine, veterinary medicine, diagnosis, diagnostics, and imaging.

Abstract: The present invention relates generally to the fields of chemistry and radionuclide imaging. More particularly, it concerns compositions, kits and methods for imaging and therapy involving N4 compounds and derivatives.

Abstract: The invention provides a family of agents that target integrins, which can be used as imaging agents and/or therapeutic agents. The agents can be used to image angiogenesis, inflammation or other physiological processes in a subject.

Abstract: Disclosed are compositions and methods useful for targeting therapeutics to cancerous cells and tumors. The disclosed targeting is useful for delivering therapeutic and detectable agents to cancerous cells and tumors.

Abstract: Functional-lipid constructs of the structure F-S-L are disclosed, wherein F comprises a tyrosine or histidine residue, S is a spacer covalently linking F to L and L is a lipid. The functional residue may be iodinated and used to radiolabel a biological entity with 1251 and the iodinated constructs are used in a non-invasive method of monitoring the distribution of a biological entity in vivo.

Abstract: Disclosed are surprising discoveries concerning the role of anionic phospholipids and aminophospholipids in tumor vasculature and in viral entry and spread, and compositions and methods for utilizing these findings in the treatment of cancer and viral infections. Also disclosed are advantageous antibody, immunoconjugate and duramycin-based compositions and combinations that bind and inhibit anionic phospholipids and aminophospholipids, for use in the safe and effective treatment of cancer, viral infections and related diseases.

Abstract: A radiolabeled annexin comprising at least 2 up to 20 histidine residues at its N-terminus is disclosed. At least two of said histidine residues are adjacent or separated by no more than one other amino acid. The radiolabeled annexin is a stable complex with a radionuclide such as technetium 99m. The radiolabeled annexin can be used in a method of imaging cell death in a nucleated cell within a region of a mammalian subject in vivo.

Abstract: The present invention relates to compounds and related technetium and rhenium complexes thereof which are suitable for imaging or therapeutic treatment of tissues, organs, or tumors. In another embodiment, the invention relates to methods of imaging tissues, organs, or tumors using radiolabeled metal complexes, particularly tissues, organs, or tumors which express certain receptors to which the compounds or complexes of the invention have an affinity. The present invention also relates to methods of treating cancer, particularly those cancer lines which express certain receptors to which the compounds or complexes of the invention have an affinity. In yet another embodiment, the present invention provides methods of imaging and/or inhibiting receptors or neuroreceptors using compounds or complexes of the invention which have an affinity for the receptor or neuroreceptor to be imaged and/or inhibited.

Abstract: The invention provides RGD-containing cyclic peptidomimetics; conjugates of said peptidomimetics and a moiety of a payload selected from fluorescent probes, photosensitizers, chelating agents, or cytotoxic agents; and pharmaceutical compositions comprising these conjugates. The conjugates of the invention are useful both for diagnostic purposes and treatment of various diseases, disorders and conditions. More specifically, conjugates comprising fluorescent probes can be used for diagnostic purposes, e.g., visualization of organs and tissues, and diagnosis of tumors; conjugates comprising photosensitizers can be used for photodynamic therapy of both tumors and nonneoplastic tissues; conjugates comprising chelating agents can be used in radioimaging or radiotherapy; and conjugates comprising cytotoxic agents can be used for targeted chemotherapy.

Abstract: The present invention is directed to novel non-invasive diagnostic tools/compounds comprising a cyclic peptide wherein the compound binds to a MSH receptor to image and treat cancers, especially, melanoma, including metastatic melanoma in vivo. The present invention represents a clear advance in the art which presently relies on tissue biopsy for diagnoses of these cancers. The novel imaging probes are capable of detecting cancerous melanoma cells, as well as their metastatic spread in tissues. This represents a quantum step forward in the diagnosis and treatment of melanoma, including metastatic melanoma using non-invasive molecular imaging techniques. The novel probes of the present invention will also be useful to initiate therapy for melanoma as well as monitor patients response to chemotherapy treatments and other interventions or therapies used in the treatment of melanoma/metastatic melanoma.

Abstract: Methods of detecting and assessing functionally active folate receptors on tumors and treatment associated with those tumors are described. Also described are methods of selecting ovarian and lung cancer patients for therapy with a folate-vinca conjugate by identifying functionally active folate receptors on the tumors of the patient. Also described are methods and compositions for treating folate receptor expressing epithelial tumors with a folate-vinca conjugate in combination with doxorubicin such as pegylated liposomal doxorubicin in which the tumors include ovarian, endometrial or non-small cell lung cancer tumors, including platinum-resistant ovarian tumors and platinum sensitive ovarian tumors. Also described are methods of treating platinum-resistant ovarian cancer using a folate-targeted drug, in the absence or presence of selecting the patient by identifying functionally active folate receptors on the tumors of the patient.

Abstract: The present invention includes a method of modulating the phagocytic activity of at least one phagocyte in a subject. The present invention also includes a method of providing a composition resistant to phagocytosis to a subject. The present invention further includes a method of treating, ameliorating or preventing an inflammatory disease in a subject.

Abstract: The present invention provides a process for [18F]-fluorination of biomolecules containing a primary amino group such as proteins and peptides and in particular of peptides. The invention further provides reagents for this process, in particular 18F-labelled prosthetic groups for use in the preparation as well as non-labelled intermediates useful in the preparation of the [18F]-labelled prosthetic groups. [18F]-labelled compounds useful as radiopharmaceuticals, specifically for use in Positron Emission Tomography (PET) are also provided.

Abstract: The present invention refers to novel dimeric proteins obtained from modified ubiquitin capable of binding targets with high affinity. The novel dimeric binding proteins comprise a combination of amino acid substitutions and at least one insertion of amino acids in one of the monomers. The invention is further directed to the use of said proteins in medical diagnosis or treatment methods.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: The present invention relates a method to make porous materials which are useful in pharmaceutical, medicine, industry, and agriculture. The most advantage of the porous materials is to provide extremely large surface area for further modification and to incorporate a bioactive reagent in a mild condition to make the porous materials bioactive, biocompatible and biodegradable.