Abstract: Product for cleaning, sanification and hygienization, comprising a base solution with sanificant and/or hygienizing action to which probiotic bacteria and bacteriophage elements are mixed; the probiotic bacteria being preferably of the Bacillus subtilis, Bacillus megaterium and Bacillus pumilus genera, while the bacteriophage elements comprise, as an alternative or in combination, bacteriophages of the Caudavirales, Microviridae, Leviviridae, Inoviridae, Tectiviridae, Corticoviridae families.

Abstract: Trehalose-based hydrogels and methods of making such hydrogels are disclosed. Specifically, a method of creating a trehalose-based hydrogel, comprising the steps of: a) forming a trehalose homopolymer or co-polymer; b) preparing a cross-linker; and c) reacting the trehalose homopolymer or co-polymer with the cross-linker to form the trehalose-based hydrogel.

Abstract: Effective treatments of pain and/or inflammation are provided. Through the administration of a porous biodegradable drug depot film, patch, strip or sponge being implantable within a nasal or sinus cavity and having pores sized to prevent the depot from functioning as a scaffold for tissue growth, one can reduce, prevent or treat pain and/or inflammation and prevent cells from infiltrating the drug depot and laying down scaffolding cells.

Abstract: Topical minocycline compositions with reduced fluorescence are provided. In some instances, the compositions include an amount of a minocycline active agent associated with porous calcium particles. Also provided are methods of using the compositions, e.g., in the treatment of acne.

Abstract: A biphasic calcium phosphate/hydroxyapatite (CAP/HAP) bone substitute material having a sintered CAP core and a closed epitactically grown layer of nanocrystalline HAP deposited on the external surface of the sintered CAP core, wherein the closed epitactically grown layer of nanocrystalline HAP deposited on the external surface of the sintered CAP core has a homogeneous coarse external surface comprising flat crystal platelets, which shows an enhanced osteogenic response, a method of promoting bone formation, bone regeneration and/or bone repair by implanting the biphasic calcium phosphate/hydroxyapatite (CAP/HAP) bone substitute material, and a process of preparation thereof.

Abstract: An active molecule delivery system whereby active molecules can be released on demand and/or a variety of different active molecules can be delivered from the same system and/or different concentrations of active molecules can be delivered from the same system. The active delivery system includes a plurality of microcells, wherein the microcells are filled with a medium including an active ingredient and charged or magnetic particles. The microcells include an opening, and the opening is spanned by a porous diffusion layer. Because the porous diffusion layer can be blocked with the charged or magnetic particles, the rate at which the active ingredient is dispensed can be controlled with an electric or magnetic field, respectively.

Abstract: A polymerizable liquid, or resin, useful for the production by additive manufacturing of a three-dimensional object of polyurethane, polyurea, or a copolymer thereof, is described. The resin includes at least one of (i) a blocked or reactive blocked prepolymer, (ii) a blocked or reactive blocked diisocyanate, or (iii) a blocked or reactive blocked diisocyanate chain extender.

Abstract: An apparatus for accumulating cross-aligned fiber in an electrospinning device, comprising a multiple segment collector including at least a first segment, a second segment, and an intermediate segment, the intermediate segment positioned between the first and second segment to collectively present an elongated cylindrical structure; at least one electrically chargeable edge conductor circumferentially resident on the first segment and circumferentially resident on the second segment; a connection point on the first segment and on the second segment, the connection points usable for mounting the elongated cylindrical structure on a drive unit to rotate around a longitudinal axis; the elongated cylindrical structure holding electrospun fiber substantially aligned with the longitudinal axis when the edge conductors are excited with a charge of opposite polarity relative to charged fiber, and attracting electrospun fiber on to its surface around the longitudinal axis at least when the edge conductors are absent

Abstract: An apparatus for collecting cross-aligned fiber threads, comprising an elongated assembly having a plurality of segments including at least a first segment, a second segment, and an intermediate segment, the first segment positioned at one end of the intermediate segment and the second segment positioned at an opposite end of the intermediate segment, each segment being electrically chargeable; an electrically chargeable emitter for electrospinning nanoscale fiber streams comprising charged fiber branches, the emitter having a tip positioned offset and between an edge of the first segment and an edge of the second segment; a support structure for rotating the elongated assembly about a longitudinal axis and applying an electrical charge to at least the edges of the first and second segment; at least one electrically chargeable steering electrode for attracting fiber streams, the at least one steering electrode chargeable with an electrical polarity opposing a charge applied to the emitter.

Abstract: Provided herein is a polymeric material comprising a polymer host; and a guest molecule comprising a glycosaminoglycan; wherein the guest molecule is disposed within the polymer host, and wherein the guest molecule is covalently bonded to at least one other guest molecule. In some embodiments, the polymer host comprises a silicone-based polymer. In other embodiments, the glycosaminoglycan is chosen from hyaluronic acid and derivatives thereof.

Abstract: The present invention provides a pharmaceutical composition comprising mesenchymal stem cells, a hyaluronan and a pharmaceutically acceptable carrier. The pharmaceutical composition is used for the treatment of the joint disease. The mesenchymal stem cells in the composition are at least one selected from the group consisting of infra-patellar fat pad stromal cells, bone marrow stem cells, Wharton's jelly stem cells and adipose derived stem cells. The concentration of the hyaluronan is in a range from 25% (v/v) to 75% (v/v). The present invention further provides a method for treating a joint disease, comprising a step of administrating a composition containing mesenchymal stem cells, a hyaluronan and a pharmaceutically acceptable carrier to an injured joint tissue of a subject.

Abstract: The present invention relates to an implant (10) comprising: a substrate (1) the surface of which comprising oxidized cellulose, said oxidized cellulose having a degree of oxidation ranging from 0.5 to 1, and a multilayer coating covering said substrate, said multilayer coating comprising at least a first layer (2) adjacent said substrate, said first layer being formed of chitosan, and a second layer (3) adjacent said first layer, said second layer being formed of oxidized cellulose having a degree of oxidation ranging from 0.5 to 1. The invention further relates to a method for preparing such an implant.

Abstract: The invention provides stable liquid formulations containing naloxone, a pharmaceutically acceptable salt or a derivative thereof. The invention further provides methods for treating opioid dependence, opioid overdose, and congenital insensitivity to pain with anhidrosis by administering the liquid formulations of the present invention intranasally to a patient in need thereof. Further, the invention provides a method of treating opioid dependence, opioid overdose, and congenital insensitivity to pain with anhidrosis by administering intranasally the naloxone formulations of the present invention.

Abstract: Embodiments of the present technology include a method of making a bone composite graft for administration to a patient. The method may include combining a human cadaveric bone material with a plurality of polymethyl methacrylate binder particles and spincasting the combined human cadaveric bone material and polymethyl methacrylate binder particles to produce the bone composite graft. The method may also include ablating the bone composite graft to increase the surface area of bone material exposed. The human cadaveric bone material may be immobilized in the plurality of polymethyl methacrylate binder particles. The human cadaveric bone material may be present in an amount that is 50 weight percent of the bone composite graft, or less. Additionally, the bone composite graft may have a yield strength that is at least 13,000 N/cm2 and no greater than 15,000 N/cm2.

Abstract: Adjunct material and methods of using adjunct material to reinforce a staple line are provided herein. In general, adjunct material can be used to maintain a seal in tissue and prevent stapled tissue from tearing. This adjunct material can be coupled to a jaw of a surgical stapler, and can be deployed into tissue along with the staples. In some embodiments, the adjunct material can be sized and shaped so that a portion of the material extends laterally outside of the staple line and distributes strain to tissue outside of the staple line. In certain aspects, sealant can be applied to the staple line and to the adjunct material in various ways to further seal the tissue and/or prevent leaks from forming in the tissue.

Abstract: A solid material adapted to kill bacteria in planktonic, spore and biofilm states is lethal toward a wide spectrum of gram positive and gram negative bacteria as well as other microbes. The solid material includes a significant amount of one or more surfactants entrained in a crosslinked polymeric network.

Abstract: Disclosed are compositions comprising a meniscal tissue. For example, disclosed are compositions comprising a meniscal tissue, wherein the meniscal tissue comprises one or more engineered channels. Disclosed are compositions comprising a meniscal tissue comprising viable cells native to the meniscal tissue and devitalized blood vessels. Disclosed are compositions comprising a previously cryopreserved meniscal tissue, wherein after cryopreservation and subsequent thawing the meniscal tissue comprises a) cells native to the meniscal tissue and greater than 30% of the cells are viable, b) extracellular matrix that is native to the meniscal tissue, c) one or more growth factors that are native to the meniscal tissue, and d) depleted amounts of one or more types of functional immunogenic cells. Also disclosed are methods of producing and using these compositions comprising meniscal tissue.

Abstract: The invention provides a device and the use thereof in a cell experiment in vitro. This device has a polydopamine layer-carboxymethyl chitosan layer-peptide layer structure, which is capable of regulating behaviors of human pluripotent stem cells and is useful in cell culture or a cell experiment in vitro.

Abstract: In one embodiment, the present invention provides a composition, wherein the composition is a porous scaffold, wherein the pores of the scaffold are from 2 to 500 microns, the composition comprising: a) a cross-linkable protein selected from the group consisting of collagen and gelatin; b) a cross-linker which induces cross-linking of the cross-linkable protein; and c) a liquid.

Abstract: One embodiment of the present invention is directed to compositions and methods for enhancing attachment of soft tissues to a metal prosthetic device. In one embodiment a construct is provided comprising a metal implant having a porous metal region, wherein said porous region exhibits a nano-textured surface.

Abstract: The present invention is related to scoring or cutting balloon catheters carrying at least on a portion of their surface at least one oxidation-insensitive drug or oxidation-insensitive polymer free drug preparation and at least one lipophilic antioxidant at a ratio of 3-100% by weight of the at least one lipophilic antioxidant in relation to 100% by weight of the drug, wherein the at least one oxidation-insensitive drug is selected of taxes, thalidomide, statins, corticoids and lipophilic derivatives of corticoids, and the at least one lipophilic antioxidant is selected of nordihydroguaiaretic acid, resveratrol and propyl gallate.

Abstract: The present application describes a two-step drug delivery formulation comprising a high affinity interaction between a drug conjugate and a compound, followed by introduction of a second compound with higher affinity to the drug conjugate to facilitate drug release. Delivery methods and specific interactions are also described.

Abstract: The present invention relates to biomaterials coated with an active agent eluting coating, wherein implantation of the coated biomaterial results in reduced implant-related complications and/or improved integration of the biomaterial into the host tissue and further relates to kits containing the coated biomaterial. The present invention also relates to methods and kits for coating the biomaterial. It is based, at least in part, on the discovery that biomaterial coated with a cytokine eluting coating resulted in the shift of early stage macrophage polarization that were associated with positive long-term effects such as minimized capsule formation and improved tissue quality and composition as compared to uncoated biomaterials.

Abstract: The present invention provides compositions for treating soft tissue injuries comprising a collagen matrix and mesenchymal stem cells adhered to the collagen matrix. Methods of making and using compositions comprising a collagen matrix and mesenchymal stem cells adhered to the collagen matrix are also provided.

Abstract: Mucus-penetrating liposomal nanoparticles and methods of making and using thereof are described herein. The nanoparticles contain one or more lipids, one or more PEG-conjugated lipids, and optionally one or more additional materials that physically and/or chemically stabilize the particles. The nanoparticle have an average diameter of about 100 nm to about 300 nm, preferably from about 100 nm to about 250 nm, more preferably from about 100 nm to about 200 nm. The particles are mobile in mucus. The liposomes can further contain one or more therapeutic, prophylactic, and/or diagnostic agent to be delivered to a mucosal surface, such as the CV tract, the colon, the nose, the lungs, and/or the eyes. The liposomes can further contain one or more CEST agents to allow real time imaging of the particles in a live animal. The particles may also further contain an imaging agent, such as a fluorescent label.

Abstract: The present invention is directed to a buprenorphine sustained release delivery system capable of delivering buprenorphine, a metabolite, or a prodrug thereof for a duration of about 14 days to about 3 months. The buprenorphine sustained release delivery system includes a flowable composition and a solid implant for the sustained release of buprenorphine, a metabolite, or a prodrug thereof. The implant is produced from the flowable composition. The buprenorphine sustained release delivery system provides in situ 1-month and 3-month release profiles characterized by an exceptionally high bioavailability and minimal risk of permanent tissue damage and typically no risk of muscle necrosis.

Abstract: A method of manufacturing a resorbable, macroporous bioactive glass scaffold comprising approximately 15-45% CaO, 30-70% SiO2, 0-25% Na2O, 0-17% P2O5, 0-10% MgO and 0-5% CaF2 by mass percent, produced by mixing with pore forming agents and specified heat treatments.

Abstract: Oriented resorbable implants made from poly-4-hydroxybutyrate (P4HB) and copolymers thereof, have been developed that contain one or more antimicrobial agents to prevent colonization of the implants, and reduce or prevent the occurrence of infection following implantation in a patient. These oriented implants are particularly suitable for use in procedures where prolonged strength retention is necessary and there is a risk of infection. Coverings and receptacles made from poly-4-hydroxybutyrate and copolymers thereof, containing antimicrobial agents, have also been developed for use with implantable devices to prevent colonization of these devices, and to reduce or prevent the occurrence of infection following implantation of these devices in a patient. These coverings and receptacles may be used to hold, or partially or fully cover, devices such as pacemakers and neurostimulators.

Abstract: A BM23 peptide is obtained by mutating and modifying BMP-2. The BM23 peptide improves stability and duration of in-vivo efficacy relative to BMP-2, has an activity of promoting the differentiation of bone marrow mesenchymal stem cells into chondrocytes and promoting the proliferation of chondrocytes and can be used for repairing cartilage and/or treating osteoarthritis.

Abstract: The present disclosure generally pertains to methods of treating non-healing wounds. Specifically, the method includes injecting amnion fluid derived cells along the periphery of the wound. The wound is then treated with a placental membrane material including a plurality of slits for increasing the membranes capacity to expand. The slits produce a mesh-like pattern in the membrane material. The amniotic derived cells deliver to the wound electrolytes, growth factors, carbohydrates, lipids, proteins, amino acids, lactate, pyruvate, enzymes, hormones and other factors useful in wound repair. The membrane material provides a scaffolding structure supporting cell growth, prevents microbial infection and decreases the rate of passive evaporative water and heat loss. The combination of the amniotic derived cells and the membrane material protects the wound and promotes cell regeneration.

Abstract: The present disclosure describes, among other things, a thermo-responsive hydrogel comprising a PNIPAM copolymer having adhesive properties that are temperature dependent, as well as a device for administering the hydrogel, and methods for making and using the foregoing.

Abstract: A method for fabricating a medical device includes steps as follows: A degradable powder including at least one metal element is firstly provided on a target surface. A focused energy light bean is applied to sinter/cure the biodegradable powder within an oxygen-containing atmosphere; wherein the oxygen concentration of the oxygen-containing atmosphere is adjusted to provide a first oxygen concentration and a second concentration when the focused energy light is driven to a first location and second location of the target surface respectively. The aforementioned processes are then repeatedly carried out to form a three-dimensional (3D) structure of the medical device.

Abstract: A coated component for use in a fluid energy device includes a coating system with multiple layers of coating material, including a soft material such as a polymer coated over a hard material such as a metal. The fluid energy device can be a fluid motor or fluid pump, and the coated component can be a rotor or a stator. The hard and soft materials may be interlocked with each other and/or with an interposed porous layer. The presence of the soft material can reduce or eliminate the need for meticulous polishing operations typically required with as-applied hard materials while improving the longevity of mating fluid energy device components. The mating components are exposed only to the soft material in the initial stages of operation, after which the soft material wears away to gradually expose the mating components to the hard material in a less abrasive manner.

Abstract: Compositions comprising an alginate, a source of sodium ions and a carrier (e.g., a pharmaceutically acceptable carrier), which are characterized by reduced association of the alginate chains and hence by at least one of: (i) a zeta potential weaker than ?25 mV, at a concentration of 0.5% (w/v) alginate in the carrier; and (ii) a diffusion coefficient of at least 10?8 cm2/second, at a concentration of 0.5% (w/v) alginate in the carrier, are disclosed. Also disclosed are uses of the composition and methods utilizing the composition for treating inflammatory bowel disease; liver damage, diseases and disorders, for treating a medical condition treatable by a hepatotoxic agent and for reducing or preventing liver damage, including liver damage caused by a hepatotoxic agent.

Abstract: The present invention is directed to a device and method for a nanofiber wrap to minimize inflation and scarring of nerve tissue and maximize the nutrient transport. More particularly, the present invention is directed to a novel semi-permeable nanofiber construct prepared from biocompatible materials. The nanofiber construct is applied around a nerve repair site following end-to-end anastomosis. The nanofiber construct is porous and composed of randomly oriented nanofibers prepare using an electrospinning method. The nanofiber construct has a wall that is approximately 50-100 ?m thick with pores smaller than 25 ?m. The nanofiber construct prevents inflammatory cells from migrating into the nerve coaption site, while still permitting the diffusion of growth factors and essential nutrients. The nanofiber construct allows for enhanced neuroregeneration and optimal function outcomes.

Abstract: The invention provides compositions and methods that are effective to improve NO production in vivo and/or to increase NO levels in blood. Such compositions and methods are useful to increase oxygenation of the brain and to improve cognitive function.

Abstract: A system for measuring analyte concentrations has porous-walled nanocontainers containing multiple magnetic nanoparticles, the magnetic nanoparticles coated with a selective binder that is analyte-responsive and binds a the analyte, an indicator substance releasable from the selective binder by the analyte, or an indicator substance cleavable by the analyte, apparatus for exposing the nanocontainers to a fluid potentially containing the analyte, and magnetic spectroscopy of Brownian motion sensing apparatus for detecting agglutination of the nanoparticles or binding of analyte to the nanoparticles.

Abstract: Methods for creating nanostructured surface features on polymers and polymer composites involve application of low pressure during curing of solid polymer material from a solvent solution. The resulting nanoscale surface features significantly decrease bacterial growth on the surface. Polymer materials having the nanoscale structuring can be used in implantable medical devices to inhibit bacterial growth and infection.

Abstract: Implantable valve for treating venous insufficiency having a self-expanding frame encased in polymer having a distal section for blood in-flow, a bulbous center section and a proximal section for blood out-flow. Polymeric leaflets have proximal ends forming a valve outlet which opens and closes in response to venous blood flow and distal portions integral with the inner polymer surface of the distal end of said bulbous section. The leaflets define a predominantly biomimetic sinus region with the bulbous section. Opening of the valve induces flushing of blood from the sinus region for smooth non-traumatic blood flow through said valve.

Abstract: A method for enhancing uptake of a therapeutic agent from the bloodstream of a patient into a disease site of the patient includes applying negative pressure to the disease site to form a pressure differential favorable for transport of the therapeutic agent from the bloodstream into the disease site. A system for enhancing uptake of therapeutic agent from the bloodstream of a patient into a disease site of the patient includes (a) a partial enclosure with edge configured to interface with an exposed surface, of the patient and overlying the disease site, to seal the partial enclosure to the exposed surface, and (b) a pump for evacuating air from the partial enclosure to produce a partial vacuum in the partial enclosure, to apply a negative pressure to the disease site so as to enhance uptake of the therapeutic agent into the disease site.

Abstract: A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 ?M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids

Abstract: More specifically, granules made of biocompatible metal material, preferably osteoinductive metal, for use in vertebroplasty surgery, as well as the use of these granules for this purpose, are the object of the present invention.

Abstract: Methods and compositions for systemically or locally administering by implantation a beneficial agent to a subject are described, and include, for example, depot gel compositions that can be injected into a desired location and which can provide controlled release of a beneficial agent over a short duration of time. The compositions include a low molecular weight biocompatible polymer, a biocompatible solvent having low water miscibility that forms a viscous gel with the polymer and limits water uptake by the implant, and a beneficial agent.

Abstract: The object of the present invention is an injectable sterile aqueous formulation, ready-to-use, resorbable, used for aesthetic purposes as a particulate, cohesive, viscoelastic gel comprising i) crosslinked hyaluronic acid, or one of its salts, at a concentration of between 0.1% and 4% (mass/volume); the crosslinking carried out providing the possibility of obtaining a gel based on crosslinked hyaluronic acid with a so-called cohesive structure, and ii) hydroxyapatite, at a concentration of between 5% and 60% (mass/volume), the hydroxyapatite being in the form of particles with an average size of less than or equal to 200 ?m; the injectable sterile aqueous formulation having viscoelastic properties such that tan ? at the frequency of 1 Hz is less than or equal to 0.60.

Abstract: The invention provides compositions and methods that are effective to improve NO production in vivo and/or to increase NO levels in blood. Such compositions and methods may be useful to improve the effects of PDE5 inhibitors, for example, on erectile dysfunction or pulmonary hypertension.

Abstract: Disclosed is directed to a method for restoring bone in an animal comprising: accessing a site to be restored; loading a syringe body with a flowable bone graft material; mating the syringe body with a delivery tube; positioning the delivery tube at the site to be restored; using a syringe piston to advance the said material into the delivery tube; using the syringe piston or a plunger that mates with the delivery tube after removal of the syringe body to deliver the bone graft to the site at a force of less than 50 lbs. extrusion force; wherein said material is at least 75% porous with a mineral to polymer ratio of 80:20.

Abstract: The present invention relates to a liposomal lupeol acetate (Lipo-LA) and its use in the treatment or prevention of rheumatoid arthritis (RA). The liposomal lupeol acetate of the present invention especially inhibits inflammatory responses and osteoclast generation (osteoclastogenesis) in the progression of rheumatoid arthritis (RA) at a half dose of the un-capsulated lupeol acetate, which may significantly reduce the incidence of RA and improve the therapeutic efficacy of lupeol acetate.

Abstract: Bio-Inks and methods of using compositions comprising the bio-Inks are disclosed. 3-D tissue repair and regeneration through precise and specific formation of biodegradable tissue scaffolds in a tissue site using the bio-inks are also provided. Specific methylacrylated gelatin hydrogels (MAC) and methacrylated chitosan (MACh) preparations formulated with sucrose, a silicate-containing component (such as laponite), and/or a cross-linking agent (such as a photo-initiator or chemical initiator), as well as powdered preparations of these, are also disclosed. Kits containing these preparations are provided for point-of-care tissue repair in vivo. Superior, more complete (up to 99.85% tissue regeneration within 4 weeks applied in situ), and rapid in situ tissue repair and bone formation are also demonstrated.

Abstract: Tissue scaffolds for neural tissue growth have a plurality of microchannels disposed within a sheath. Each microchannel comprises a porous wall having a thickness of ?about 100 ?m that is formed from a biocompatible and biodegradable material comprising a polyester polymer. The polyester polymer may be polycaprolactone, poly(lactic-co-glycolic acid) polymer, and combinations thereof. The tissue scaffolds have high open volume % enabling superior (linear and high fidelity) neural tissue growth, while minimizing inflammation near the site of implantation in vivo. In other aspects, methods of making such tissue scaffolds are provided. Such a method may include mixing a reduced particle size porogen with a polymeric precursor solution. The material is cast onto a template and then can be processed, including assembly in a sheath and removal of the porogen, to form a tissue scaffold having a plurality of porous microchannels.

Abstract: A method for manufacturing an animal acellular tissue matrix material and a tissue matrix material manufactured by the same. The tissue matrix material manufactured by the method retains an original basic scaffold structure of a tissue extracellular matrix, with an antigen causing immunological rejection in a human body being effectively removed from the animal tissue. An animal dermal matrix manufactured by the method retains the biological integrity of a natural dermal tissue matrix and can be used for restoration and repair of lesion and missing tissues.