Abstract: Detergent compositions may include endoglucanase variants and methods of using such detergent compositions. The endoglucanase may have an alteration at one or more positions where the variant has at least 60% but less than 100% sequence identity to SEQ ID NO: 2.

Abstract: A method for producing an objective protein and a method for producing a disaccharide are provided. An objective protein is produced by culturing Talaromyces cellulolyticus in a culture medium containing an expression inducer such as gentiobiose. A disaccharide is produced from a saccharide raw material by enzymatic conversion using a disaccharide synthesizing enzyme.

Abstract: The present invention refers to a plant or plant part comprising a polynucleotide encoding a wildtype or mutated cellulose synthase (CESA) polypeptide, the expression of said polynucleotide confers to the plant or plant part tolerance to CESA-inhibiting herbicides, such as azines.

Abstract: The present invention relates to xanthan lyase variants and methods for obtaining xanthan lyase variants. The present invention also relates to polynucleotides encoding the variants; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and methods of using the variants.

Abstract: The invention relates to a method for separating, from a culture medium, an enzymatic cocktail and the fungus Trichoderma Reesei, the culture medium resulting from enzyme production by the fungus, method in which: said culture medium is subjected, in a period of no longer than 30 h from the halting of production, to a separation on a filter press lined with a fabric having a porosity of 3-20 ?m, so as to obtain a filtrate having a corrected optical density OD at 600 nm of less than 2.5; and the liquid phase obtained is subjected to tangenital micro-filtration on a ceramic membrane having a cut-off limit of 0.5 to 1.4 ?m, so that the corrected OD at 600 nm does not exceed 0.1.

Abstract: The present invention is related to an in vitro method for diagnosing Gaucher's disease in a subject comprising a step of a) detecting a biomarker in a sample from the subject, wherein the biomarker is free lyso-Gb1.

Abstract: Disclosed herein are cellulase variants, or active fragments thereof, and polynucleotides encoding same, where the cellulase variants, or active fragments thereof, have endoglucanase activity. Also disclosed herein are compositions comprising the cellulase variants, or active fragments thereof; vectors and/or host cells comprising the polynucleotides encoding the cellulase variants, or active fragments thereof; and methods for making and/or using the cellulase variants, or active fragments thereof and/or compositions containing same; where the cellulase variants, or active fragments thereof, have endoglucanase activity.

Abstract: The present disclosure relates to detergent compositions comprising xanthan lyase variants and methods for use of said compositions.

Abstract: The present disclosure relates to a detergent composition comprising endoglucanase variants and methods for use of said compositions.

Abstract: A mutant ?-glucosidase polypeptide exhibits enhanced thermostability and has the amino acid sequence: MAKFPRDFVWGTATSSYQIEGAVNEDGRTPSIWDTFSKTX1GKTYKGHT GDVACDHYHRYKEDVEILKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDF YKKLIDELQKRDIX2PAATIYHWDLPQWAYDKGGGWLNRESIKWYVEYA TKLFEELGDAIPLWITHNEPWCSSILSYGIGEHAPGHKNYREALIAAHH ILLSHGEAVKAFREMNIKGSKIGITLNLTPAYPASEKEEDKLAAQYADG FANRWELDPIFKGNYPEDMMELYSKIIGEFDFIKEGDLETISVPIDFLG X3NYYTRSIVKYDEDSMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD REYTKLPMYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIGE GGNLKGYFVWSLMDNFEWAHGYSKRFGIVYVDYX4TQKRILKDSALWYK EVIX5DDGIED, wherein X1 is selected from E, P, T, M, A, S and G; X2 is selected from V, K, R and H; X3 is selected from I, L, M, P, T and A; X4 is selected from T, E, D, N, Q, M and P; and X5 is selected from L, R, K and H.

Abstract: The application relates to a polypeptide having beta-glucosidase activity, its method of production and its uses.

Abstract: The present invention relates to the expression and optimization of enzymes involved in the breakdown of lignocellulosic biomass. Disclosed are variants of the exoglucanase 1 of Trichoderma reesei, as well as the use of said variants with improved efficiency in methods for breaking down cellulose and for producing biofuel.

Abstract: The present invention relates to a novel endoglucanase gene (GH5 family) from the soil metagenome. More specifically, this invention provides a recombinant plasmid and the recombinant hosts for the expression of novel gene sequence having cellulase activity. The cellulase in the invention has high specific activity towards ?-1,4 linkages in substrates such as carboxy-methyl cellulose and barley-?-glucan etc. This novel cellulase can have many industrial applications eg. food and feed industry, detergent, textile and biofuel industry etc.

Abstract: The present invention refers to a plant or plant part comprising a polynucleotide encoding a wildtype or mutated cellulose synthase (CESA) polypeptide, the expression of said polynucleotide confers to the plant or plant part tolerance to CESA-inhibiting herbicides, such as azines.

Abstract: Disclosed herein are methods of making multifunctional microbial cellulases. The engineered multifunctional microbial cellulases disclosed herein exhibit improved activity over native cellulases.

Abstract: The present invention is directed to a cleaning composition including one or more Class III or Class IV BslA (Biofilm surface layer A) proteins and a surfactant system including one or more anionic surfactants and one or more co-surfactants, in a weight of ratio of less than 9:1. Methods of making and using such compositions are also provided.

Abstract: The aim of the invention is to improve the secretion of a protein from a host cell in order to increase the product yield of protein in a fermentation process. This is achieved by an expression vector comprising a) a promoter sequence and b) a nucleic acid sequence that codes for a protein. The protein comprises a signal peptide and an additional amino acid sequence, and the signal peptide comprises an amino acid sequence that is at least 80% identical to the amino acid sequence specified in SEQ ID NO: 2, at least 80% identical to the amino acid sequence specified in SEQ ID NO: 4, at least 80% identical to the amino acid sequence specified in SEQ ID NO: 6, or the signal peptide comprises an amino acid sequence that is structurally homologous to at least one of said sequences.

Abstract: A xylosidase having improved enzymatic activity is disclosed. The amino acid sequence of the xylosidase is a modified amino acid sequence of SEQ ID NO: 2, wherein the modification is a substitution of phenylalanine at position 35 with glutamate, and/or a substitution of glutamine at position 41 with histidine.

Abstract: The present invention relates to variants of cellobiohydrolase, preferably Cbh1, which have greater cellobiohydrolase activity. The invention also relates to a genetic construct, a host cell and to an enzyme composition comprising said variants. The invention further relates to a procedure for producing fermentable sugar and a procedure for producing a bioproduct, such as bioethanol, from cellulose material with the cellobiohydrolase variants, the host cell or the enzyme composition comprising said variants.

Abstract: The present invention relates to isolated polypeptides having protease activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides in e.g. animal feed and detergents.

Abstract: An object is to provide a mutant of a cellulase-producing microorganism which produces a cellulase capable of preferentially producing a cello-oligosaccharide during the selective production of the cello-oligosaccharide through enzymolysis of a cellulosic material in the presence of the cellulase, a method for producing the cellulase and a method for producing a cello-oligosaccharide using the cellulase. The present invention relates to a mutant of a cellulase-producing microorganism, in which cellobiohydrolase and ?-glucosidase genes are disrupted.

Abstract: The present invention relates to polypeptides having mannanase activity, catalytic domains, and carbohydrate binding modules, and polynucleotides encoding the polypeptides, catalytic domains, and carbohydrate binding modules. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains, and carbohydrate binding modules.

Abstract: Disclosed herein is a pulverulent ceramide producing method that enables easily and efficiently extracting and separating ceramide from sugar beet pulp, and efficiently pulverizing the ceramide by spray drying. The pulverulent ceramide can be efficiently obtained by a process that includes concentrating, with and/or without adding water, a sugar beet pulp ethanol extract obtained by extraction of a sugar beet pulp (for example, such as a beet fiber) with ethanol, adding pectinase to the resulting concentrate and performing an enzymatic reaction, performing emulsification after inactivating the enzyme, and pulverizing the resulting emulsion using spray drying.

Abstract: A novel insecticidal chitinase protein from fern Tectaria sp., a process for preparation of the insecticidal protein and nucleic acid sequence encoding for said insecticidal protein and its application for insect control purposes.

Abstract: The invention relates to novel variants of fungal endoglucanases, their production and means for their production. Especially the invention relates to variants of Acremonium thermophilum Cel45A. The invention further relates to enzyme preparations and detergent compositions comprising at least one novel variant endoglucanase as well as to processes for treating cellulosic material therewith. The novel variant endoglucanase polypeptides have improved performance in textile applications, especially in biofinishing and biostoning, and in detergent applications, in fabric care and color maintenance, especially in prevention and removal of fuzz and pills, in color care and revival.

Abstract: The present invention relates to cellulolytic compositions for degrading or converting cellulose-containing material and methods of producing and using the compositions.

Abstract: Polypeptides having endoglucanase activity, catalytic domains, and polynucleotides encoding the polypeptides or catalytic domains. Nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides or catalytic domains.

Abstract: The present invention relates to isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains or cellulose binding domains.

Abstract: The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Abstract: An Aspergillus mutant strain characterized in that it is an auxotrophic mutant strain of Aspergillus oryzae strain AOK27L.

Abstract: Methods to introduce highly phosphorylated mannopyranosyl oligosaccharide derivatives containing mannose-6-phosphate (M6P), or other oligosaccharides bearing other terminal hexoses, to carbonyl groups on oxidized glycans of glycoproteins while retaining their biological activity are described. The methods are useful for modifying glycoproteins, including those produced by recombinant protein expression systems, to increase uptake by cell surface receptor-mediated mechanisms, thus improving their therapeutic efficacy in a variety of applications.

Abstract: The present invention relates to new enzymes with improved properties and to compositions comprising these enzymes suitable for use in the production of a food, feed, or malt beverage product, such as in a brewing process.

Abstract: The present invention relates to isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains or cellulose binding domains.

Abstract: The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and an organic compound. The present invention also relates to methods of using the compositions.

Abstract: A hyperthermostable endoglucanase including an endoglucanase catalytic domain, the endoglucanase catalytic domain including: (A) a polypeptide including an amino acid sequence represented by SEQ ID NO: 1; (B) a polypeptide including an amino acid sequence in which at least one amino acid is deleted, substituted, or added in the amino acid sequence represented by SEQ ID NO: 1, and having hydrolytic activity using p-nitrophenyl-?-D-cellobioside as a substrate at least under conditions of a temperature of 100° C. and a pH of 5.5; or (C) a polypeptide including an amino acid sequence having at least 70% sequence identity with the amino acid sequence represented by SEQ ID NO: 1, and having hydrolytic activity using p-nitrophenyl-?-D-cellobioside as a substrate at least under conditions of a temperature of 100° C. and a pH of 5.5.

Abstract: The present invention relates to methods for degrading or converting a cellulosic material and for producing substances from the cellulosic material under high temperature conditions.

Abstract: Provided are isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. Also provided are nucleic acid constructs, vectors and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides catalytic domains or cellulose binding domains.

Abstract: The present invention relates to the production of sugar hydrolysates from cellulosic material. The method may be used e.g. for producing fermentable sugars for the production of bioethanol from lignocellulosic material. Cellulolytic enzymes and their production by recombinant technology is described, as well as uses of the enzymes and enzyme preparations.

Abstract: The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Abstract: The present disclosure is generally directed to enzymes and in particular beta-glucosidase variants. Also described are nucleic acids encoding beta-glucosidase variants, compositions comprising beta-glucosidase variants, methods of using beta-glucosidase variants, and methods of identifying additional useful beta-glucosidase variants.

Abstract: The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Abstract: The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and a dioxy compound. The present invention also relates to methods of using the compositions.

Abstract: The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Abstract: The present invention relates to the method for manufacturing textile, by treating textile with an isolated polypeptide having endoglucanase activity, especially in biostoning and bio-polishing process.

Abstract: Methods for hydrolyzing okara using endopeptidase and/or endoglucanase enzymes are disclosed. The hydrolyzed okara has a diminished water-holding capacity and is useful for supplementing the protein and fiber content of food products.

Abstract: The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Abstract: The present invention relates to cellobiohydrolase variants having improved thermostability in comparison to wild-type CBH2a.

Abstract: Methods for consolidated pretreatment and hydrolysis of genetically engineered plants expressing cell wall degrading enzymes are provided. Expression cassettes and vectors for making transgenic plants are described. Plants engineered to express one or more cell wall degrading enzymes using expression cassettes and vectors of the invention are also provided.

Abstract: The present invention relates to a depilling composition comprising an enzyme mixture that comprises a Family 45 cellulase and one or more additional cellulases selected from a Family 5 cellulase, a Family 6 cellulase or a combination thereof. The enzyme mixture may be characterized in that the Family 45 and Family 5 cellulases or the Family 45 and Family 6 cellulases are present at a weight ratio that exhibits synergy in an assay that measures specific depilling activity. The enzyme mixture may be secreted by a genetically modified microbe overexpressing the foregoing cellulases. Also provided is a process for depilling that comprises a step of contacting cellulose-containing goods with the depilling composition.

Abstract: In alternative embodiments, the invention provides polypeptides having a lignocellulolytic (lignocellulosic) activity, e.g., a ligninolytic and cellulolytic activity, including, e.g., a glycosyl hydrolase, a cellulase, an endoglucanase, a cellobiohydrolase (cbhl) (e.g., an exo-cellobiohydrolase, e.g., having an “exo” activity that can processively release cellobiose units ?-1,4 glucose-glucose disaccharide), a beta-glucosidase, a xylanase, a mannanse, a xylosidase (e.g., a (?-xylosidase) and/or an arabinofuranosidase activity, polynucleotides encoding these polypeptides, and methods of making and using these polynucleotides and polypeptides. In one embodiment, the invention provides thermostable and thermotolerant forms of polypeptides of the invention. The polypeptides and nucleic acids of the invention are used in a variety of pharmaceutical, agricultural and industrial contexts; for example, as enzymes for the bioconversion of a biomass, e.g.