Abstract: A new gene--MN--and proteins/polypeptides encoded therefrom are disclosed. Recombinant nucleic acid molecules for expressing MN proteins/polypeptides and fusion proteins are provided. Expression of the MN gene is disclosed as being associated with tumorigenicity, and the invention concerns methods and compositions for detecting and/or quantitating MN antigen and/or MN-specific antibodies in vertebrate samples that are diagnostic/prognostic for neoplastic and pre-neoplastic disease. Test kits embodying the immunoassays of this invention are provided. MN-specific antibodies are disclosed that can be used diagnostically/prognostically, therapeutically, for imaging, and/or for affinity purification of MN proteins/polypeptides. Also provided are nucleic acid probes for the MN gene as well as test kits comprising said probes. The invention also concerns vaccines comprising MN proteins/polypeptides which are effective to immunize a vertebrate against neoplastic diseases associated with the expression of MN proteins.

Abstract: An antibody which binds to the CD30 antigen and a) inhibits the release of sCD30 from Hodgkin's disease cells, and b) does not bind to B cell non-Hodgkin's lymphomas or plasma cells. An example of such antibodies are the antibodies secreted from hybridoma cell line DSM ACC 2204. The antibodies may be used for diagnosis, or conjugated to a toxin to produce an immunotoxin.

Abstract: The invention relates to monoclonal antibodies against a tumor-associated antigen which is mainly derived from tumors from the group of carcinomas of the breast, ovaries and prostate, as well as adenocarcinomas of the lung, which additionally react with polymorphic epithelial mucin (PEM), to the preparation and use thereof and to the use of the epitope defined by the antibody for diagnosis and therapy.

Abstract: The invention provides a wide range of methods and compositions for detecting and treating cervical cancer in an individual. Specifically, the invention provides target cervical cancer-associated proteins, which permit a rapid detection, preferably before metastases occur, of cervical cancer. The target cervical cancer-associated protein, may be detected, for example, by reacting the sample with a labeled binding moiety, for example, a labeled antibody capable of binding specifically to the protein. The invention also provides kits useful in the detection of cervical cancer in an individual. In addition, the invention provides methods utilizing the cervical cancer-associated proteins either as targets for treating cervical cancer or as indicators for monitoring of the efficacy of such a treatment.

Abstract: The present invention relates to human foam cells generated in vitro from monocyte/macrophage related cell lines which give rise to an average intracellular cholesterol amount of at least 139+36 ug/mg cell protein as determined by HPLC, with said cholesterol being characterized by a degree of 46+6% of esterification as determined by HPLC. The invention also relates to monoclonal antibodies selected via said foam cells and which can be used for pharmaceutical and diagnostic purposes.

Abstract: The monoclonal antibody produced by a hybridoma cell strain TRD-L1, -L2 or -L3 which is obtained by the fusion between mouse myeloma cells and spleen cells of a mouse immunized with a human lung adenocarcinoma cell secretion component reacts in a specific fashion with a glycoprotein antigen that has a molecular weight of 200 kD or more (SDS-PAGE) and is present in human lung adenocarcinoma cells. It can be used efficiently in cancer diagnosis.

Abstract: The present invention provides a nucleic acid sequence encoding a melanoma antigen recognized by T lymphocytes, designated MART-1. This invention further relates to bioassays using the nucleic acid sequence, protein or antibodies of this invention to diagnose, assess or prognoses a mammal afflicted with melanoma or metastata melanoma. This invention also provides immunogenic peptides derived from the MART-1 melanoma antigen and a second melanoma antigen designated gp100. The proteins and peptides provided can serve as an immunogen or vaccine to prevent or treat melanoma.

Abstract: The present invention provides a human tumor-associated Kazal inhibitor (HuKI) and polynucleotides which identify and encode HuKI. The invention also provides expression vectors, host cells, antibodies and antagonists. The invention also provides methods for the prevention and treatment of diseases associated with expression of HuKI, as well as diagnostic assays.

Abstract: A new gene--MN--and proteins/polypeptides encoded therefrom are disclosed. Recombinant nucleic acid molecules for expressing MN proteins/polypeptides and recombinant proteins are provided. Expression of the MN gene is disclosed as being associated with tumorigenicity, and the invention concerns methods and compositions for detecting and/or quantitating MN antigen and/or MN-specific antibodies in vertebrate samples that are diagnostic/prognostic for neoplastic and pre-neoplastic disease. Test kits embodying the immunoassays of this invention are provided. MN-specific antibodies are disclosed that can be used diagnostically/prognostically, therapeutically, for imaging, and/or for affinity purification of MN proteins/polypeptides. Also provided are nucleic acid probes for the MN gene as well as test kits comprising said probes.

Abstract: This invention provides for recombinant single chain antibodies capable of specifically binding to a Lewis.sup.Y -related carbohydrate antigen and fusion proteins comprising these antibodies. More particularly, the invention provides for single chain Fv regions of the monoclonal antibodies B1 and B5. The invention also provides for a number of stabilizing mutations of the Lewis.sup.Y -binding monoclonal antibody B3. In addition, the invention provides for methods of detecting cells bearing a Lewis.sup.Y antigen in a patient and for methods of killing or inhibiting the growth of cells bearing a Lewis.sup.Y antigen in a patient.

Abstract: The present invention provides a monoclonal anti-idiotype antibody 3H1 that escapes immune tolerance and elicits a specific immune response to CEA in mice, rabbits, monkeys, and patients with advanced CEA-associated disease. This invention also provides compositions which can be used in the detection or treatment of CEA-associated tumors mimics a specific epitope on carcinoembryonic antigen and a hybridoma that produces 3H1.

Abstract: This invention concerns a subset of composite Hum4 V.sub.L, V.sub.H antibodies with high affinities to a high molecular weight, tumor-associated sialylated glycoprotein antigen (TAG-72) of human origin. These antibodies have variable regions with (1) V.sub.L segments derived from the human subgroup IV germline gene, and (2) a V.sub.H segment which is capable of combining with the V.sub.L to form a three dimensional structure having the ability to bind TAG-72. In vivo methods of treatment and diagnostic assay using these composite antibodies is also disclosed.

Abstract: A qualitative, quantitative, as well as local determination of pyruvatkinase (ATP:pyruvate-2-O-phosphotransferase, EC 2.7.1.40)-isoenzyme typ M2 (Tumor-M2-PK) is possible in blood, plasma, tissue culture, tissue sections as well as in the animal and human organism with the help of antibodies.Corresponding antisera are obtained if highly purified pyruvatekinase-isoenzymes type M2 (Tumor-M2-PK) or fragments of these, are used as immunogen. Preferable are antisera with monoclonal antibodies.These antibodies can be used in ELISA-Test systems for the diagnosis of cancer, to determine the malignancy of cells, to localize a tumor in an organism as well as for the therapy of cancer.

Abstract: Antibodies are disclosed which bind to ErbB3 protein and further possess any one or more of the following properties: an ability to reduce heregulin-induced formation of an ErbB2-ErbB3 protein complex in a cell which expresses ErbB2 and ErbB3; the ability to increase the binding affinity of heregulin for ErbB3 protein; and the characteristic of reducing heregulin-induced ErbB2 activation in a cell which expresses ErbB2 and ErbB3.

Abstract: A molecule which (i) binds human membrane-bound carcinoembryonic antigen, (ii) binds a hybrid polypeptide consisting of residues 1 to 314 of human biliary glycoprotein joined (N-C) to residues 490 to C-terminus of human carcino embryonic antigen, but (iii) does not bind to human biliary glycoprotein excluding an intact mouse monoclonal antibody comprising an IgG group IIA heavy chain and a kappa group V light chain wherein the sequence of the V.sub.H chain is QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWIN-TKTGEATYVEEFKGRFAFSLE TSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS, or wherein the sequence of the V.sub.H chain is as given immediately above but the first amino acid residue of the V.sub.H CDR1 is glutamine and in either case the sequence of the V.sub.L chain is GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG-SGTDFT LTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. Preferably the molecule is a monoclonal antibody.

Abstract: This invention relates generally to the field of immunology, in particular that of antibodies and antibody productions. More specifically, this invention relates to bispecific antibodies, the hybrid hybridomas which produce them, the parent hybridomas, the production and selection of the hybridomas and hybrid hybridomas, and the purification of the bispecific antibodies. Specific examples relate to bispecific monoclonal antibodies which recognize both the human multi-drug resistance antigen, P-glycoprotein and human Fc.gamma. receptor III (hFc.gamma.RIII). These bispecific antibodies are useful in killing cancer cells.

Abstract: Novel compositions are provided that are derived from antigen-binding sites of immunoglobulins having affinity for cancer antigens. The compositions exhibit immunological binding properties of antibody molecules capable of binding specifically to a human tumor cell displaying a MDR phenotype. A number of synthetic molecules are provided that include CDR and FR regions derived from same or different immunoglobulin moieties. Also provided are single chain polypeptides wherein V.sub.H and V.sub.L domains are attached by a single polypeptide linker. The sFv molecules can include ancillary polypeptide moieties which can be bioactive, or which provide a site of attachment for other useful moieties. The compositions are useful in specific binding assays, affinity purification schemes, drug or toxin targeting, imaging, and genetic or immunological therapeutics for various cancers.

Abstract: There are produced recombinant gene pairs which endow mononuclear cells, mainly various lymphocyte type cells, with antibody-type specificity. In specific gene pairs the rearranged gene pairs code for a binding site of an antibody molecule from the same species, of the T-cell receptor gene, or another species. Gene pairs of the invention code, for example, for antibodies specific towards tumor-specific antigens, viral antigens, modified self antigens, bacterial or fungal antigens, autoimmune type disease antigens and the like. The invention further relates to expression vectors for the effective transfection of such cell types comprising such a recombinant gene pair, to methods for producing same and to pharmaceutical compositions comprising as active ingredient an effective quantity of lymphocytes transfected with such gene pairs.

Abstract: There are produced recombinant gene pairs which endow mononuclear cells, mainly various lymphocyte type cells, with antibody-type specificity. In specific gene pairs the rearranged gene pairs code for a binding site of an antibody molecule from the same species, of the T-cell receptor gene, or another species. Gene pairs of the invention code, for example, for antibodies specific towards tumor-specific antigens, viral antigens, modified self antigens, bacterial or fungal antigens, autoimmune type disease antigens and the like. The invention further relates to expression vectors for the effective transfection of such cell types comprising such a recombinant gene pair, to methods for producing same and to pharmaceutical compositions comprising as active ingredient an effective quantity of lymphocytes transfected with such gene pairs.

Abstract: Construction of a single gene encoding a signal-chain immunoglobulin-like molecule is described. This single-gene approach circumvents inefficiencies inherent in delivering two genes into a mammalian cell and in the assembly of a functional immunoglobulin molecule. It also facilitates ex vivo transfection of cells for gene-therapy protocols. The single-chain protein comprises the heavy- and light-chain variable (V.sub.H and V.sub.L) domains of a monoclonal antibody covalently joined through a short linker peptide, while the carboxyl end of a V domain is linked to the amino terminus of a human constant region such as .gamma.1 Fc, through the hinge region. The single-chain protein assembles into a dimeric molecule of .apprxeq.120 kDa and is secreted into the culture fluid. The single-chain immunoglobulin-like protein shows similar antigen binding affinity to that of chimeric or parental antibody and mediates ADCC.

Abstract: A monoclonal or other antibody to the carbohydrate antigen Tn can be used to inhibit or slow the progression of AIDS or ARC. The antigen can be used in a vaccine, for immunisation.

Abstract: Monoclonal antibodies to adenocarcinoma cells, and, in particular, breast carcinoma cells, are produced by a hybridoma formed by fusing mouse lymphocytes and mouse myeloma cells. The monoclonal antibodies are capable of shrinking solid tumors associated with human breast. The monoclonal antibodies identify an antigen associated with carcinomas of ductal lineage. The monoclonal antibodies, specifically, F36/22 monoclonal antibodies, can be used diagnostically and therapeutically.

Abstract: Disclosed is a substantially pure antibody which specifically binds a LCF polypeptide and methods of using such antibodies.

Abstract: Disclosed herein are therapeutic treatment protocols designed for the treatment of B cell lymphoma. These protocols are based upon therapeutic strategies which include the use of administration of immunologically active mouse/human chimeric anti-CD20 antibodies, radiolabeled anti-CD20 antibodies, and cooperative strategies comprising the use of chimeric anti-CD20 antibodies and radiolabeled anti-CD20 antibodies.

Abstract: A chimeric LL2 monoclonal antibody is described in which the complementarity determining regions (CDRs) of the light and heavy chains of the murine LL2 anti-B-lymphoma, anti-leukemia cell monoclonal antibody has been recombinantly joined to the human kappa and IgG.sub.1 constant region domains, respectively, which retains the immunospecificity and B-cell lymphoma and leukemia cell internalization capacity of the parental murine LL2 monoclonal antibody, and which has the potential of exhibiting reduced human anti-mouse antibody production activity. A humanized LL2 monoclonal antibody is described in which the CDRs of the light and heavy chains have been recombinantly joined to a framework sequence of human light and heavy chains variable regions, respectively, and subsequently linked to human kappa and IgG.sub.

Abstract: Provided is a method for reproducible production of cytokeratin antigen/immunogen. Cytokeratins from whole carcinoma cells are purified by preparative SDS-PAGE. Bands corresponding to cytokeratins 8, 18, and 19 are eluted from the gel, and these cytokeratins are digested to produce fragments in the size range of 10-50 Kd. The invention also relates to use of these fragments as immunogens for the production of antibodies. Furthermore, the invention relates to an immunochemical test kit to detect cancer of epithelial origin in body fluids. The kit comprises cytokeratin fragments produced by the method of the invention and antibodies to these fragments.

Abstract: A method of inhibiting the growth of a tumor cell in a mammal by administering to the mammal an autoantibody, e.g, an antinuclear autoantibody from an aged mammal, that binds to either one or both of a surface of a tumor cell and a protein released from a dead tumor cell. Also disclosed are natural and monoclonal antinuclear autoantibodies from aged mammals and a hybridoma cell line producing a monoclonal antinuclear autoantibody.

Abstract: Disclosed herein are therapeutic treatment protocols designed for the treatment of B cell lymphoma. These protocols are based upon therapeutic strategies which include the use of administration of immunologically active mouse/human chimeric anti-CD20 antibodies, radiolabeled anti-CD20 antibodies, and cooperative strategies comprising the use of chimeric anti-CD20 antibodies and radiolabeled anti-CD20 antibodies.

Abstract: Antibodies made to a flanking region GPR(31-98) in human gastrin-releasing peptide (GRP) precursor. Since the antibodies have high affinity to GRP precursor, and the GPR precursor is highly stable in the blood, then lung cancer, especially small cell lung cancer can be diagnosed with high reliability by detecting or measuring GRP precursor in the blood of a patient using the present antibodies.

Abstract: A human monoclonal antibody specifically binding to a surface antigen of cancer cell membrane, an isolated DNA encoding the antibody, and a hybridoma producing the antibody. An anti-cancer formulation comprising the monoclonal antibody bonded to the surface of a liposome enclosing an anti-cancer agent or toxin is also provided.

Abstract: An antibody against peanut agglutinin-(PNA)-binding glycoprotein on the surface of cells is named 103B2 and registered at the German Collection of Microorganisms and Cell Cultures GmbH, DSMZ, under the Budapest Treaty.

Abstract: Monoclonal antibodies to prostatic cells, are produced by a hybridoma formed by fusing mouse lymphocytes and mouse myeloma cells. The monoclonal antibodies show specificity for a non-soluble, membrane associated, organ specific antigenic determinant limited in its distribution to human prostate epithelial cells and normal prostatic epithelial cells. The monoclonal antibodies, specifically, 7Ell monoclonal antibodies, can be used diagnostically and therapeutically.

Abstract: This invention concerns monoclonal antibodies directed against breast carcinoma cells. Immunoglobulin secreting hybridoma cultures are produced by hybridoma technology using undifferentiated breast cancer cells as antigens for immunization. Hybridomas secreting antibodies highly reactive with tumor proliferating cells are selected. These monoclonal antibodies have particular application in aiding the diagnosis or treatment of cancer.

Abstract: The invention relates to monoclonal antibodies of high avidity, which react specifically with the gangliosides GD3 and GQ1b, and to their use for detecting melanomas and other tumors or tissues expressing GD3 and GQ1b.

Abstract: This invention provides a family of monoclonal antibodies specific for epitopes of p110.sup.RB protein present in the nucleus. These antibodies have superior properties that prove useful for the detection of p110.sup.RB or its complexes with other cellular regulatory proteins in cells and in cell lysates. This invention also provides hybridoma cell lines that produce such monoclonal antibodies and methods of using these antibodies diagnostically, prognostically and therapeutically. Further, the invention provides a method for isolating proteins associated with p110.sup.RB proteins.

Abstract: The invention relates to monoclonal antibodies against a tumor-associated antigen which is mainly derived from tumors from the group of carcinomas of the breast, ovaries and prostate, as well as adenocarcinomas of the lung, which additionally react with polymorphic epithelial mucin (PEM), to the preparation and use thereof and to the use of the epitope defined by the antibody for diagnosis and therapy.

Abstract: Monoclonal antibodies, in particular 33.28 and 31.1, and chimeric antibodies, in particular mouse/human chimeric Chi #1 specific for glycoprotein antigens of colon carcinoma-associated antigens which are immunogenic in humans, are disclosed. Such antibodies, and fragments and derivatives thereof, are useful in immunodiagnosis and immunotherapy of human colon, breast, and ovarian cancer, and for purification of antigens which can serve as immunotherapeutic agents. Methods of detecting the colon carcinoma-associated antigen in a sample, and methods for treating subjects having colon, breast, and ovarian carcinomas are disclosed.

Abstract: The invention relates to monoclonal antibodies and parts thereof which bind preferentially to active human platelets, to the nucleotide sequence and amino-acid sequence of the heavy and light chain of MAb BW 2128 and to an antigen associated with thrombospondin.

Abstract: Antibodies, polyclonal and monoclonal, which are capable of specifically binding to a human interleukin-6 receptor. Also included are monoclonal antibodies which competitively and non-competitively inhibit human interleukin-6, and a method of producing hybridomas of the said monoclonal antibodies capable of specifically binding to a human interleukin-6 receptor.

Abstract: Combinations of monoclonal antibodies which are highly effective for inhibiting cell growth and methods for inhibiting cell growth employing novel combinations of monoclonal antibodies are disclosed. The antibodies employed are capable of binding to the human transferrin receptor glycoprotein and, in combination, usually exhibit a substantially greater inhibition of cell growth than either of the antibodies individually when administered in comparable amounts, e.g. at saturation conditions. In preferred combinations, at least one member of the combination is individually highly effective to inhibit cell growth and at least one other member of the combination is individually substantially ineffective to inhibit cell growth. Combinations are selected based upon an in vitro screening test using CCRF-CEM cells which express the human Tf receptor.

Abstract: Antibodies which recognize a tumor related antigen designated CA55.1 such as hybridoma 55.1 deposited as ECACC deposit no. 93081901 in which the complementarity determining regions have the following sequences:a) heavy chainCDR1 G Y W I H (SEQ ID NO: 27)CDR2 E V N P S T G R S D Y N E K F K N (SEQ ID NO: 28)CDR3 E R A Y G Y D D A M D Y (SEQ ID NO: 29)b) light chainCDR1 K S S Q S L L N S R T R K N Y L A (SEQ ID NO: 30)CDR2 W A S T R T S (SEQ ID NO: 31)CDR3 K Q S Y T L R T (SEQ ID NO: 32)or a conservative analogue thereof. The peptide ACEHRGSGWC (SEQ ID NO: 26), as displayed on the surface of bacteriophage NCIMB No. 40638, is a mimic of the tumor related antigen CA55.1.

Abstract: The invention relates to the identification of insoluble cytoskeletal proteins, or fragments thereof, which are characteristic of the origin of the tissue. The invention relates as well to the method for detecting such proteins by breaking down and solubilizing the protein for immunological detection and quantitation. The method allows detection of tissue lesions or other pathological foci and metastases.

Abstract: The invention relates to a new antigen termed BLA-36 specifically expressed on the surface of Hodgkin's cells, Reed-Sternberg cells and B lymphocytes, and to a new monoclonal antibody (anti-BLA-36) specific thereto. The antigen is characterized by the following properties:a molecular weight of about 36,000 D;the presence of an epitope recognized by antibody to said protein;specific expression by Hodgkin's cells and Reed-Sternberg cells in all subsets of Hodgkin's disease, and by activated and early proliferating B cells;no expression by T cells;capability of reacting with its antibody in both frozen and fixed/paraffin embedded tissues;a function associated with the growth of cells capable to express said antigen protein.

Abstract: Monoclonal antibodies to adenocarcinoma cells, and, in particular, breast carcinoma cells, are produced by a hybridoma formed by fusing mouse lymphocytes and mouse myeloma cells. The monoclonal antibodies are capable of shrinking solid human breast tumors xenografted in nude mice. The monoclonal antibodies identify an antigen associated with carcinomas of ductal lineage. The monoclonal antibodies, specifically, F36/22 monoclonal antibodies, can be used diagnostically and therapeutically.

Abstract: The present invention provides a low cost, less toxic, anti-cancer immunotherapy which enhances the host's immune system ability to destroy or contain cancers, and also provides a diagnostic test for cancer. Specifically, the present invention provides monoclonal antibodies specific for, that is, specifically bind, oncofetal protein (OFP), a cancer cell product. Tumors treated with a single dose of the monoclonal antibodies against OFP are markedly reduced in size, and leukemic populations of cells treated with a single does of monoclonal antibodies against OFP are significantly decreased in number. Since the monoclonal antibodies of the present invention do not bind to tumor cells, the monoclonal antibody treatment overcomes the disadvantages associated with tumor cell targeting. Monoclonal antibodies to OFP offer a simple and inexpensive agent for use as a primary or adjuvant therapy against a wide variety of cancers and tumors in humans and other animals.

Abstract: Monoclonal antibodies immunoreactive with tumor-associated antigen, CA 215 which is present on an ovarian tumor cell line, fragments of those antibodies (either radiolabeled, bound to a toxin, or unlabeled), and the cell line which secretes them are described.

Abstract: Antibodies, both polyclonal and monoclonal, recognize and bind human villin. Hybridomas, producing monoclonal antibodies which bind human villin, are also provided.

Abstract: Murine monoclonal antibodies are prepared and characterized which bind selectively to high molecular weight mucins by immunoprecipitation test and are IgGs or IgMs. Immunotoxins comprising the monoclonal antibody and cytotoxic moiety were produced.

Abstract: The present invention relates to a family of novel antigens associated with malignant cells of bladder carcinomas, and to antibodies, portions or fragments thereof, or single domain antibodies which recognize those antigens. The invention provides methods of detecting bladder carcinomas using those antibodies, fragments or portions thereof, or single domain antibodies, to kits for use in those methods and to methods of treating bladder carcinoma using the antibodies, fragments or portions thereof, or single domain antibodies.

Abstract: Three unique monoclonal antibodies, each having an epitope located in amino acids 1-181 of the WT1 tumor protein, and the hybridomas which secrete them have been constructed. These monoclonal antibodies are useful in the detection, monitoring, and diagnosis of malignancies characterized by inappropriate expression of the WT1 protein.