Abstract: The invention relates to a method of obtaining an antibody with a desired function, the method comprising: a) bringing a population of B cells into contact with a capturing agent; b) separating the captured B cells from the uncaptured B cells; c) culturing a plurality of captured B cells wherein said B cells have not been sorted into single B cells immediately prior to culturing; d) screening a plurality of the cultured cells to identify cells capable of producing an antibody with the desired function; and e) obtaining the desired antibody therefrom.

Abstract: Monoclonal antibody that specifically binds to alpha-amylase and is useful for detecting weather damage (i.e. pre-harvest sprouting) in cereal grain.

Abstract: Methods of detecting and/or quantifying an IgE antibody present in a liquid sample. The IgE antibody is specific to a ligand in the form of an antigen, an antibody, or a hapten. These methods can be used for monitoring and evaluating the immunological status of a subject.

Abstract: Heart and brain fatty acid binding proteins (H-FABP, B-FABP) are markers for stroke. The invention provides a diagnostic assay for either of these markers, preferably by ELISA using a anti-H-FABP or B-FABP antibody. Since H-FABP is also a marker for acute myocardial infarction (AMI), to distinguish stroke from AMI requires an assay specific to AMI, e.g. using troponin-1 or CK-MB as a marker, also to be carried out.

Abstract: Antibodies having specific binding for the parent THC (?9-THC) and its major metabolites are provided which present a significant increase in sensitivity of immunoassays such as lateral flow immunoassays and ELISA for THC. The present invention also provides a rabbit hybridoma producing the antibody as a monoclonal antibody, a recombinant antibody, further molecularly engineered recombinant antibodies against parent ?9-THC and its metabolites and cell lines producing the recombinant antibodies. The invention also provides applications of the antibody in immunoassays, particularly lateral flow immunoassays, specifically applications in detecting THC in body fluids, particularly saliva, and kits for determining the presence of THC.

Abstract: The present invention provides isolated polypeptides having an amino acid sequence having at least 70% identity to SEQ ID NO:20, wherein the polypeptide has ER-?36 activity. The invention further provides methods for identifying agents that bind to such polypeptides, methods for detecting such polypeptides, and methods for altering the activity of such polypeptides. Also provided are antibodies that specifically bind to an amino acid sequence depicted at SEQ ID NO:1, or an immunogenic fragment thereof, and methods for making and using such antibodies.

Abstract: The invention relates to a method for the detection of inflammations, in particular of inflammatory processes in the tissue of mammary glands in humans or animals, in particular in cattle and a test-kit for carrying out said method. The method is particularly suitable for the specific detection of inflammations in mammary glands, for example during testing of milk, whereby the enzyme implicated in inflammatory processes prostaglandin D synthase (PGDS) is qualitatively or quantitatively determined.

Abstract: The present invention provides a new sensitive direct sandwich assay for determining the presence of COMP in a clinical sample. Two monoclonal antibodies directed against separate antigenic determinants of the COMP molecules are used in the assay. The invention also relates to three particularly advantageous monoclonal antibodies per se that are directed against human COMP. Cell cultures manufacturing these antibodies have been deposited according to the Budapest Treaty at Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, and have been assigned accession numbers DSM ACC2406, DSM ACC2408 and DSM ACC2418, respectively. A diagnostic kit comprising at least two of these monoclonal antibodies also constitute a part of the present invention.

Abstract: The invention includes compositions, kits and methods comprising a monoclonal antibody which shares key functional properties with the polyclonal antibodies which participate in the pathogenesis of heparin induced thrombocytopenia/thrombosis (HIT/HITT) in a mammal. The monoclonal antibody of the invention preferentially binds with a PF4/heparin complex relative to the binding of the antibody with PF4 or heparin alone. The monoclonal antibody of the invention also binds specifically with PF4 in a complex with other glycosaminoglycans besides heparin, and also activates platelets. The monoclonal antibody of the invention is useful in methods for diagnosing and treating HIT/HITT in a mammal. A humanized version of the monoclonal antibody of the invention is also included, along with a process for humanizing the monoclonal antibody of the invention.

Abstract: The invention is related to a method of predicting the response to a treatment with a HER inhibitor in a patient comprising the steps of assessing a biomarker or a combination of biomarkers selected from the group consisting of amphiregulin, an epidermal growth factor, a transforming growth factor alpha, and a HER2 biomarker in a biological sample from the patient and predicting the response to the treatment with the HER inhibitor in the patient by evaluating the results of the first step. Further uses and methods wherein these markers are used are disclosed.

Abstract: The invention provides methods and compositions for simultaneously detecting the activation state of a plurality of proteins in single cells using flow cytometry. The invention further provides methods and compositions of screening for bioactive agents capable of coordinately modulating the activity of a plurality of proteins in single cells. The methods and compositions can be used to determine the protein activation profile of a cell for predicting or diagnosing a disease state, and for monitoring treatment of a disease state.

Abstract: The invention provides methods and compositions for simultaneously detecting the activation state of a plurality of proteins in single cells using flow cytometry. The invention further provides methods and compositions of screening for bioactive agents capable of coordinately modulating the activity of a plurality of proteins in single cells. The methods and compositions can be used to determine the protein activation profile of a cell for predicting or diagnosing a disease state, and for monitoring treatment of a disease state.

Abstract: Antibodies to heavy chain of human FcRn are provided which function as non-competitive inhibitors of IgG binding to FcRn. The antibodies may be polyclonal, monoclonal, chimeric or humanized, or antigen binding fragments thereof. These antibodies are useful for reducing the concentration of pathogenic IgGs in individuals and therefore used as a therapeutic tool in autoimmune and alloimmune conditions.

Abstract: A method for detection and/or quantification of cardiac troponin I (cTnI) in a sample derived from an individual's blood, the method being based on a sandwich immunoassay employing at least two capture antibodies and at least one tracer antibody, in which a first capture antibody is directed to the N-terminal part of cTnI, to the C-terminal part of cTnI or to the part of the cTnI midfragment, which is slightly affected by the interfering factor, and a second capture antibody is directed to another of these parts, and a tracer antibody is directed to the N-terminal part of cTnI, to the C-terminal part of cTnI or to TnC, which is complexed with cTnI.

Abstract: The invention concerns agonist anti-trkC monoclonal antibodies which mimic certain biological activities of NT-3, the native ligand of trkC. The invention further concerns the use of such antibodies in the prevention and/or treatment of cellular degeneration, including nerve cell damage associated with acute nervous cell system injury and chronic neurodegenerative diseases, including peripheral neuropathy.

Abstract: Using two types of antibodies, i.e., a first antibody having a higher affinity for a target substance than for a competitive substance and a second antibody having a higher affinity for the competitive substance than for the target substance, a specimen is treated with these two antibodies. Then, the competitive substance in the specimen first binds to the second antibody and thus the ratio of the target substance to the competitive substance in the specimen is enlarged. As a result, the target substance becomes liable to bind to the first antibody and, in its turn, the reactivity of the target substance is elevated compared with the case of using the first antibody alone. Thus, the target substance in the specimen can be accurately assayed while avoiding the effects of the competitive substance contained in the specimen.

Abstract: A method having clinically sufficient degree of diagnostic accuracy for detecting the presence of coronary artery disease in a human patient from the general population and for distinguishing between the stages of the disease in that patient is disclosed. The stages are, first, the non-acute stage, which is either asymptomatic coronary artery disease or stable angina, second, the acute stage known as unstable angina, and, third, the acute stage known as acute myocardial infarction. The diseased state (as opposed to the non-diseased state) is indicated by the clinically significant presence of a first marker in a sample from the patient. The presence of one of the two acute stages, unstable angina or acute myocardial infarction, is indicated by the clinically significant presence of a second marker in a sample from the patient. The presence of the more severe acute stage known as acute myocardial infarction is indicated by the clinically significant presence of a third marker in a sample from the patient.

Abstract: Assay systems and specialized antibodies for the detection and quantitation of troponin I and troponin T in body fluids as an indicator of myocardial infarction. Since troponin I and T exist in various conformations in the blood, the ratios of the monomeric troponin I an T and the binary and ternary complexes, as well as which form of troponin present in the blood, may be related to the metabolic state of the heart. Disclosed is a system to determine the presence of a troponin form or a group of troponin forms in a sample of whole blood, serum or plasma. Disclosed is a stabilized composition of troponin; the stabilized composition can comprise a stabilized composition of troponin I, wherein the troponin I is oxidized, the troponin I can be unbound or the troponin I can be in a complex.

Abstract: The anti-19P2 ligand monoclonal antibodies of the invention (in particular P2L-1Ca) have very high binding ability and can neutralize the arachidonic acid metabolite releasing activity of the 19P2 ligand. Therefore, they can be used, among others, as diagnostic, prophylactic and/or therapeutic agents for various diseases caused by some or other abnormality in the pituitary function modulating activity (e.g. prolactin secretion promoting activity), central nervous system modulating activity and pancreatic function modulating activity, among others, supposedly possessed by the 19P2 ligand.

Abstract: A method for identifying or monitoring SLE in an individual is provided. The method includes quantitating complement component C4d on the surfaces of platelets and comparing the amounts of C4d to reference levels of C4d on platelets of individuals without SLE and/or on platelets of the individual obtained at a different time. Kits for use in the above-described methods are provided along with computer readable media tangibly embodying executable instructions to perform the methods.

Abstract: The invention is related to methods of diagnosing inflammatory diseases or conditions by determining levels of components of the complement pathway on the surface of white blood cells.

Abstract: A lagomorph derived monoclonal antibody for recognizing the progesterone receptor (PR) (clone SP2) with immunohistochemistry and methods for creating such an antibody are disclosed. No need of target retrieval in immunohistochemistry is their prominent advantage compared to currently available PR antibody. Furthermore, the very low background when the lagomorph derived monoclonal antibody is used in immunohistochemistry is also impressive. The immunohistochemistry comparative study with about fifty clinical specimens showed that the new PR antibody (clone SP2) antibody had favorable results when compared to mouse monoclonal antibody PR (clone 1A6), the best one in the current market. The PR antibody may prove of great value in the assessment of PR status in human breast cancer. Humanized versions of the PR antibody may provide therapeutic benefits.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. (SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO:2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: The invention provides methods and compositions for simultaneously detecting the activation state of a plurality of proteins in single cells using flow cytometry. The invention further provides methods and compositions of screening for bioactive agents capable of coordinately modulating the activity of a plurality of proteins in single cells. The methods and compositions can be used to determine the protein activation profile of a cell for predicting or diagnosing a disease state, and for monitoring treatment of a disease state.

Abstract: A method of rapidly assaying nucleotide receptor P2X7 pore activity in white blood cells contained within a blood sample. A method according to the invention includes the steps of: (a) labeling the white blood cells with a white blood cell-specific label; (b) depolarizing the labeled white blood cells with an isotonic depolarizing solution; (c) contacting the labeled white blood cells with a dye and a P2X7 agonist in an amount sufficient to activate nucleotide receptor P2X7 pore activity; (d) contacting the labeled white blood cells with a divalent cation in an amount sufficient to deactivate nucleotide receptor P2X7 pore activity; and (e) analyzing dye uptake in labeled white blood cells whereby nucleotide receptor P2X7 pore activity is quantified by the amount of dye taken up in labeled white blood cells treated with P2X7 agonist relative to labeled white blood cells in the absence of P2X7 agonist.

Abstract: A biochemical analysis unit has a flow-through area in which plural spot areas are arranged, and probes are spotted onto the spot areas. The biochemical analysis unit is set into a chamber of a reaction vessel. A reaction solution containing a target is supplied through an inlet into the chamber. A flow rate is adjusted such that the pressure loss may be 80 kPa when the reaction solution flows through the flow-through area. When the pressure loss is increased, the reaction solution flows through the flow-through area after equivalently spreading into a lower side of the chamber. Thus the flowing speed is decreased.

Abstract: The present invention provides an assay, suitable for neonatal screening of hemoglobinopathies by quantitatively determining the presence of at least one pair of hemoglobin (Hb) variants, determining the ratio between the signals obtained from each variant; and, based on that ratio, determining whether the tested subject is afflicted or not.

Abstract: Antibodies have been developed against the different molecular forms of urokinase using synthetic peptides as immunogens. The peptides were synthesized specifically to represent those regions of the urokinase molecules which are exposed in the three-dimensional configuration of the molecule and are uniquely homologous to urokinase. Antibodies are directed against the lysine 158-isoleucine 159 peptide bond which is cleaved during activation from the single-chain (ScuPA) form to the bioactive double chain (54 KDa and 33 KDa) forms of urokinase and against the lysine 135 lysine 136 bond that is cleaved in the process of removing the alpha-chain from the 54 KDa form to produce the 33 KDa form of urokinase. These antibodies enable the direct measurement of the different molecular forms of urokinase from small samples of conditioned medium harvested from cell cultures.

Abstract: Disclosed herein are novel trisulfonated tribenzo-mononahptho-porphyrazines, processes for making them and their application as improved photosensitizing drugs for the treatment of various medical conditions by photodynamic therapy (PDT). These water-soluble amphiphilic porphyrazines are substituted with different alkylyl, aryl, aminoalkyl and aminoaryl groups, with or without carboxyl moeity.

Abstract: The present invention provides BAG3 nucleotide and protein sequences to be used in research, diagnostics and therapy for modulation of cell survival and/or death, in particular in leukemias, other neoplasias and apoptosis-involving diseases. More particularly the invention refers to the use of specific antisense-based constructs and peptide-specific polyclonal and monoclonal antibodies in leukemias, other neoplasias and cell death-involving diseases.

Abstract: A specific and sensitive in vitro ELISA assay and diagnostic test kit is disclosed for determining levels of NT-proBNP protein in a variety of bodily fluids, non-limiting examples of which are blood, serum, plasma, urine and the like. The NT-proBNP ELISA assay test employs the sandwich ELISA technique to measure circulating NT-proBNP in human plasma. In order to obtain antibodies with specific binding properties for targeted amino acid sequences within human proBNP, recombinant human proBNP (or rhproBNP) was expressed and purified for use as an immunogen. Polyclonal antibodies (PAb) to specific amino acid sequences were subsequently purified from goat serum by sequential affinity purification. Monoclonal antibodies were raised against specific polypeptides. Recombinant human NT-proBNP (or rhNT-proBNP) was expressed and purified in order to obtain material for use in calibration of a quantitative method for measurement of human NT-proBNP.

Abstract: The present invention relates to a rabbit monoclonal antibody that binds to human Id1 protein and/or mouse Id1 protein with high specificity and high affinity. The antibody has a binding constant, measured with respect to human Id1 protein and/or mouse Id1 protein, equal to or greater than 1×108/molar. The antibody has no substantial cross-reactivity with other family Id proteins such as Id2, Id3, or Id4, or other endogenous proteins present in the cells that express Id1 protein. The high specificity and high affinity of the rabbit monoclonal antibodies of the present invention allows sensitive and specific detection and/or quantitation of Id1 protein in biological samples. The antibodies are useful in immunochemical-based assays such as ELISA, western blot, and immunohistochemical staining.

Abstract: Novels immuno-interactive fragments of the (alpha)C portion of a mammalian inhibin alpha subunit are disclosed, together with their variants and derivatives for producing antigen-binding molecules that are interactive with said (alpha)C portion, which are chemically well defined and which can be produced in commercially significant quantities. The antigen-binding molecules of the invention can be used for the detection of a mammalian inhibin and for the treatment and/or prevention of conditions associated with aberrant levels of a mammalian inhibin.

Abstract: The present invention concerns an immunological test for determining NT-proBNP comprising at least two antibodies to NT-proBNP, wherein at least one of the antibodies to NT-proBNP is a monoclonal antibody. One of these antibodies is directed at least against parts of the epitope of NT-proBNP comprising the amino acids 38 to 50. In addition, one of these antibodies is directed at least against parts of the epitope of NT-proBNP comprising the amino acids 1 to 37 or 43 to 76. The epitope recognized by the antibodies can slightly overlap.

Abstract: The binding specificity of a monoclonal antibody is altered by exposing the monoclonal antibody to an oxidizing agent or an electric potential.

Abstract: Novel bactericidal antibodies against Neisseria meningitidis serogroup B (“MenB”) are disclosed. The antibodies either do not cross-react or minimally cross-react with host tissue polysialic acid and hence pose minimal risk of autoimmune activity. The antibodies are used to identify molecular mimetics of unique epitopes found on MenB or E. coli K1. Examples of such peptide mimetics are described that elicit serum antibody capable of activating complement-mediated bacteriolysis of MenB. Vaccine compositions containing such mimetics can be used to prevent MenB or E. coli K1 disease without the risk of evoking autoantibody.

Abstract: A method for determining the concentration of factor VIIa-antithrombin complexes is disclosed which has application to estimating the level of intravascular exposure of tissue factor, assessing patient risk for hypercoagulation or other coagulopathies, and monitoring patients for factor VIIa-antithrombin complexes over time which can reveal changes in risk for hypercoagulation or other coagulopathies and/or effectiveness of anticoagulant therapy. Antibodies suitable for use in an in vitro assay for determining the concentration of factor VIIa-antithrombin complexes and methods for making the same are also disclosed.

Abstract: Embodiments of the invention generally provide methods and compositions for producing polyvalent antigens. In one aspect, the invention provides a method for producing a cross-linked antigen. In another aspect, the invention provides a method of using cross-linked products as antigens to immunize animals and induce strong immune responses.

Abstract: The present invention provides a method of determining whether an individual is at risk for atherosclerosis, comprising the step of: measuring the level of carbamylated LDL in a sample obtained from said individual. Further provided is a method of reducing carbamylation in an individual in need of such reducing, comprising the step of: treating said individual with a monomeric amino acid or another enzymatic or non-enzymatic inhibitor of carbamylation. Also provided is a method of preventing carbamylation in an individual with normal renal function, comprising the step of: treating said individual with a monomeric amino acid. Further provided is a method of treating or preventing atherosclerosis in an individual in need of such reducing, comprising the step of: inhibiting aggregation and/or deposition of carbamylated LDL in said individual.

Abstract: The invention concerns a kit for the detection of protein ESM-1 in a sample, comprising: a) a first antibody specifically binding to the N-terminal region of protein ESM-1 contained between the amino acid in position 20 and the amino acid in position 78 of the amino acid sequence of this protein; and b) a second antibody specifically binding to the C-terminal region contained between the amino acid in position 79 and the amino acid in position 184 of the amino acid sequence of protein ESM-1.

Abstract: The present application discloses a solid support material having covalently immobilized thereon an affinity ligand, said ligand comprising one or more hydrophobic functional group(s) and one or more cationic functional group(s) or one or more heteroaromatic functional group(s), wherein at least one hydrophobic functional group is separated from at least one cationic/heteroaromatic functional group by a through bond distance of from 5 ? to 20 ?, wherein said ligand has a molecular weight of from 120 Da to 5,000 Da. Typically, the affinity resin has a binding capacity larger than 5 mg monoclonal antibody per mL of affinity resin. A method for the isolation of biomolecules, such as proteins, in particular antibodies, such as monoclonal antibodies, or derivatives thereof, is also disclosed.

Abstract: Novel conjugates of docetaxel and novel docetaxel immunogens derived from the 7 and 10 positions of docetaxel and monoclonal antibodies generated by these docetaxel linked immunogens are useful in immunoassays for the quantification and monitoring of docetaxel in biological fluids.

Abstract: The present invention includes antibodies to human GW182 protein and the use of those antibodies in clinical and diagnostic assays.

Abstract: Antibodies are described, which are suitable for identification of ?-carboxyglutamic acid (Gla), said antibodies having an ability of identifying Gla residues in proteins and/or peptides, while not reacting with glutamic (Glu) residues in corresponding proteins and/or peptides. Methods for the preparation and identification of said antibodies as well as methods for detection of Gla in biological fluids, tissue extracts, tissue specimens, in which methods said antibodies are used, are also described. There is also described the use of said antibodies for immunopurification of Gla-containing proteins or peptides by, for instance, immunoprecipitation or immunoaffinity chromatography.

Abstract: A reagent and method for the specific and highly sensitive detection of C. parvum in which the reagent is an antibody for a soluble C. parvum sporozoite antigen and the method is an immunoassay in which the antibody is used to detect or quantify C. parvum sporozoite antigen in a sample. The sample is treated to cause excystation of C. parvum oocytes, thereby releasing a C. parvum sporozoite antigen, and combined with antibodies specific for the sporozoite antigen under conditions to form an antibody-antigen complex. Detection of the complex indicates the presence of C. parvum in the sample. The assay allows recognition and detection of C. parvum in turbid samples, and due to a lack of crossreactivity with other Cryptosporidium species, is specific for C. parvum contamination or infection. The assay is highly sensitive, allowing for the detection of less than 100 oocysts per milliliter of sample.

Abstract: A method and test device for differentiating between states of an analyte that can exist in different forms, such as follicle stimulating hormone (FSH). The method or test device uses a pair of specific binding agents, especially monoclonal antibodies, in two assays for the same analyte. The assays, applied to contemporaneous samples, differ from one another in format, one being a two step assay and the other being one step. A novel pair of anti-FSH monoclonal antibodies that can be used together in two such assays to differentiate pre-menopausal and post-menopausal FSH samples is disclosed.

Abstract: Disclosed herein are kits for detecting RANKL protein or nucleic acids, the kits comprising isolated human RANKL polypeptides, RANKL nucleic acids and/or antibodies specific for RANKL.

Abstract: The invention provides cDNAs which encodes a signal peptide-containing proteins. It also provides for the use of a cDNA, protein, and antibody in the diagnosis, prognosis, treatment and evaluation of therapies for cancer. The invention further provides vectors and host cells for the production of the protein and transgenic model systems.

Abstract: The present invention provides a method of predicting pregnancy outcome in a subject by determining the amount of an early pregnancy associated molecular isoform of hCG in a sample. The present invention further provides a method for determining the amount of early pregnancy associated molecular isoforms of human chorionic gonadotropin (hCG) in a sample. The present invention also provides a diagnostic kit for determining the amount of early pregnancy associated hCG is a sample. The present invention additionally provides an antibody which specifically binds to an early pregnancy associated molecular isoform of human chorionic gonadotropin. Finally, the present invention provides methods for detecting trophoblast or non-trophoblast malignancy in a sample.

Abstract: A sandwich immunoassay kit for detecting ciguatoxins based on a combination of two anti-ciguatoxin CTX3C monoclonal antibodies produced by hybridomas, 3D11 (deposited at IPOD, AIST under accession number FMRM PB-8293) and 10C9 (FMRM PB-8292). In particular, one of the antibodies is labeled and each of them binds specifically to a different site of ciguatoxin CTX3C.