Periodontitis Patents (Class 514/900)
-
Patent number: 8998616Abstract: Laser ablation is used in curettage to treat periodontal disease. After an initial step of ablating afflicted tissues, an anti-microbial rinse is applied. A flexible fiber optic guide is the preferred means of directing radiant energy to the afflicted tissues. Sulcular disinfection may also be achieved by similar associated processes. Various anti-microbial agents and laser sources are disclosed.Type: GrantFiled: November 28, 2007Date of Patent: April 7, 2015Assignee: CAO Group, Inc.Inventors: Densen Cao, Steven Jensen
-
Patent number: 8975275Abstract: The invention relates to the use of chemotherapeutic agents for the production of a medicament for the topical and/or local treatment of diseases caused by bacteria and/or for prophylaxis in humans or animals.Type: GrantFiled: December 22, 2000Date of Patent: March 10, 2015Assignee: Bayer Innovation GmbHInventors: Hans-Herrmann Schulz, Günther Schlimbach
-
Patent number: 8945596Abstract: The present invention relates to an antimicrobial composition. It particularly relates to an antimicrobial composition for cleansing or personal care. It is an object of the present invention to provide antimicrobial compositions that have relatively fast antimicrobial action. Present inventors have surprisingly found that compositions comprising selected ingredients, namely thymol and terpineol, in selective proportions provide relatively quick antimicrobial action.Type: GrantFiled: October 8, 2009Date of Patent: February 3, 2015Assignee: Conopco, Inc.Inventors: Amit Chakrabortty, Srilaxmi Venkata Medepalli
-
Patent number: 8795638Abstract: This invention pertains to dental care compositions with antimicrobial benefits. In particular, the invention provides for compositions of oral tissue-adherent salts that release biocidal ions on a controlled release basis and thereby provide and maintain an essentially uniform concentration of biocidal ions above the MBC or MIC of the target bacteria at the site of application in the mouth for an extended period of time. The compositions are useful for treating or preventing oral diseases resulting from bacteria, fungal or yeast infections, such as caries, gingivitis, periodontal disease and candidiasis.Type: GrantFiled: October 6, 2011Date of Patent: August 5, 2014Assignee: Nevada Naturals Inc.Inventors: Anthony Errol Winston, Richard F. Stockel, Anthony Joseph Sawyer
-
Patent number: 8741267Abstract: A periodontal medicament composition comprising povidone iodine, an agar carrier, and optionally a bio-compatible, radio-opaque salt, for treating periodontal disease is disclosed, along with a method for preparing the same. A method is also disclosed for delivering the periodontal medicament composition, while in a liquid state, into the periodontal pocket of a patient afflicted with periodontitis whereupon due to the unique properties of the agar carrier, it solidifies to the contours of the periodontal pocket to form a periodontal medicament implant for releasing the povidone iodine over a period of time.Type: GrantFiled: June 26, 2009Date of Patent: June 3, 2014Inventor: Joseph P. Trovato
-
Patent number: 8652444Abstract: Antiplaque oral compositions are provided that contain an orally acceptable carrier and an antibacterial effective amount of the compound of formula (I). In various embodiments, the compositions contain from about 0.001% to about 10% by weight of the compound of formula (I).Type: GrantFiled: November 9, 2011Date of Patent: February 18, 2014Assignee: Colgate-Palmolive CompanyInventors: Ravi Subramanyam, Prem Sreenivasan
-
Patent number: 8377424Abstract: This invention relates to a method of therapeutic or prophylactic treatment of periodontal disease comprising administering to a subject in need thereof a polymeric compound of formula An. Also disclosed and claimed is an article of manufacture comprising the above compounds packaged within a container with instructions for use, and methods of making thereof.Type: GrantFiled: December 3, 2004Date of Patent: February 19, 2013Assignee: Mars, IncorporatedInventors: Leo J. Romanczyk, Jr., Harold H. Schmitz
-
Patent number: 8343556Abstract: A method for treating periodontal disease, which comprises administering an effective amount of a composition to one in need of treatment of periodontal disease, the composition comprising a Sasa extract and an organic acid.Type: GrantFiled: August 13, 2007Date of Patent: January 1, 2013Assignee: Hououdou Co., Ltd.Inventors: Yuuzou Tsuchida, Mitsuo Kawabe, Kunitomo Watanabe, Kotarou Tsuchida
-
Patent number: 8343483Abstract: New strains of Lactobacillus that have been selected for their capability of improved reduction the number of Streptococcus mutans in the mouth of mammals through inhibiting activity in combination with better binding to the oral mucins and dental plaque, thereby preventing, reducing or treating dental caries, and products derived from said strains, including agents for treatment or prophylaxis of caries for administration to humans.Type: GrantFiled: October 15, 2008Date of Patent: January 1, 2013Assignee: Biogaia ABInventors: Bo Mollstam, Eamonn Connolly
-
Patent number: 8337819Abstract: The invention is a pharmaceutical composition for the oral hygiene for the treatment of the periodontal illnesses and the Halitosis. It consists of a mixture 0.01 to 5 g of Hydrogen Peroxide; 0.001 to 0.5 g of Eugenol: 0.001 to 0.5 g of Permonochlorophenol; 0.001 to 0.3 g of Camphor; 10 to 40 g of Maltitol; 0.01 to 0.1 g of coloring matter; 0.1 to 1 g of appetizing substance and enough quantity of demineralized water to complete 100 g of oral pharmaceutical preparation.Type: GrantFiled: September 15, 2006Date of Patent: December 25, 2012Inventor: Tomas Bernardo Galvan
-
Patent number: 8258307Abstract: The present invention provides a new amide compound and salt thereof that is capable of inhibiting biofilm formation or removing deposited biofilms. The present invention also provides a biofilm formation inhibitor or a biofilm remover containing the amide compound or salt thereof as an active ingredient. An amide compound or salt thereof according to the present invention is denoted by General Formula (1): wherein R1 is a hydrogen atom or a hydroxyl group, R2 is a C5-12 alkyl group, and Q is a substituent denoted by Formula (Q1) or (Q2), wherein n and m are 0 or 1.Type: GrantFiled: November 6, 2007Date of Patent: September 4, 2012Assignees: University of Tokyo, Otsuka Chemical Co., Ltd.Inventors: Hiroaki Suga, Jun Igarashi
-
Patent number: 7972137Abstract: Compositions and methods are directed to antimicrobial compositions and articles that release ?NO from the composition and/or article in an amount effective to prevent gingival and other oral mucosal diseases.Type: GrantFiled: June 25, 2004Date of Patent: July 5, 2011Inventor: Gerald M. Rosen
-
Patent number: 7850996Abstract: The use of selenite- or selenate-containing preparations supplemented with pharmaceutically acceptable or food-compatible acids for the preparation of an agent intended for topical or buccal application or mucosal administration is described.Type: GrantFiled: December 4, 2002Date of Patent: December 14, 2010Assignee: Vis-Vitalis Lizenz-Und Handels AGInventors: Peter Kössler, Norbert Fuchs, Bodo Kuklinski
-
Patent number: 7846422Abstract: The present invention relates to a method for prevention or treatment of periodontal diseases, containing administering lignans represented by the following formula (1) (wherein R1 represents a hydrogen atom or a hydroxyl group; R2, R3, R4 and R5 are the same or different and each represents a hydrogen atom, a hydroxyl group, a C1-10 alkyl group, a hydroxy C1-10 alkyl group or a C1-10 alkoxy group) or plant extracts containing the lignans.Type: GrantFiled: August 3, 2004Date of Patent: December 7, 2010Assignee: Kao CorporationInventors: Kazushi Oshino, Ikuhisa Ichimura, Hisataka Kobayashi, Minoru Takizawa, Hidetake Fujinaka
-
Patent number: 7829067Abstract: A composition and method for treating periodontal infections and gingivitis includes an extract of Centipeda cunninghami, coenzyme Q10, aloe vera and folic acid. The composition also contains additional plant extracts and nutrients that are effective in cell reproduction, wound healing and provide antibacterial and anti-inflammatory effects. The composition is applied to the teeth and gums to inhibit bacterial growth and reduce inflammation of the gums.Type: GrantFiled: March 3, 2004Date of Patent: November 9, 2010Assignee: Bio-Botanica, Inc.Inventors: Frank S. D'Amelio, Sr., Youssef W. Mirhom
-
Patent number: 7776914Abstract: The invention is directed to compositions comprising lecithin, olive oil, esterified fatty acids and mixed tocophenols for use in the treatment and prevention of various types of arthritis and other inflammatory joint conditions, periodontal diseases and psoriasis, which avoid many of the side effects associated with known treatments. The compositions of the present invention have the advantage of increased stability, a reduction of arachidonic acid in cells, a reduction in eicosanoid production and enhanced cell regulation and communication. Also disclosed are methods for using the compositions for treatment and prevention.Type: GrantFiled: June 16, 2009Date of Patent: August 17, 2010Assignee: Imagenetix, Inc.Inventors: William P. Spencer, Patrick S. Millsap
-
Patent number: 7652000Abstract: Methods of treating and/or preventing surface infections, such as acne, in an animal, such as a human being, using antibiotics incorporating borinic acid complexes, especially picolinic acid derivatives, are disclosed, along with compositions of these antibiotics.Type: GrantFiled: June 14, 2005Date of Patent: January 26, 2010Assignee: Anacor Pharmaceuticals, Inc.Inventors: David Perry, Kirk R. Maples, Carolyn Bellinger-Kawahara
-
Patent number: 7612111Abstract: The invention is directed to compositions comprising lecithin, olive oil, esterified fatty acids and mixed tocophenols for use in the treatment and prevention of various types of arthritis and other inflammatory joint conditions, periodontal diseases and psoriasis, which avoid many of the side effects associated with known treatments. The compositions of the present invention have the advantage of increased stability, a reduction of arachidonic acid in cells, a reduction in eicosanoid production and enhanced cell regulation and communication. Also disclosed are methods for using the compositions for treatment and prevention.Type: GrantFiled: March 22, 2004Date of Patent: November 3, 2009Assignee: Imagenetix, Inc.Inventors: William P. Spencer, Patrick S. Millsap
-
Patent number: 7279151Abstract: This invention relates to novel dental compositions and methods for preventing dental plaque and caries formation and generally for inhibiting tooth decay and brightening/whitening teeth. The compositions of this invention comprise herbs such as Citrus karna raf., Zanthoxylum armatum D.C. and Azadirachta indica A. Juss. thereof which can be combined with pharmaceutically acceptable carriers or diluents to be administered in the form of conventional dental compositions. The compositions of the present invention, also preferably, contain Mint.Type: GrantFiled: March 25, 2004Date of Patent: October 9, 2007Assignee: Council of Scientific and Industrial ResearchInventors: Palpu Pushpangadan, Chandana Venkateswara Rao, Sanjeev Kumar Ojha, Kuttan Pillai Narayanan Nair, Madan Mohan Pandey, Ajay Kumar Singh Rawat, Shanta Mehrotra
-
Patent number: 7217691Abstract: Purified BMP-2 and BMP-4 proteins and processes for producing them are disclosed. The proteins may be used in the treatment of bone and cartilage defects and in wound healing and related tissue repair.Type: GrantFiled: March 27, 2003Date of Patent: May 15, 2007Assignee: Genetics Institute, LLCInventors: Elizabeth Wang, John M. Wozney, Vicki A. Rosen
-
Patent number: 7192573Abstract: There are provided oral mouth rinse compositions, consisting essentially of: a) 1–20 wt % of an orally acceptable peroxide, b) 0.5–15 wt % of an orally acceptable sulfate, bisulfate, pyrosulfate salt of an inorganic cation or mixtures thereof, and c) water to 100 wt %. There are further provided methods of preparing and using said compositions as well as kits for maintaining the components to prepare said compositions.Type: GrantFiled: December 22, 2004Date of Patent: March 20, 2007Inventors: Leonard Mackles, William S Bess
-
Patent number: 7087249Abstract: The invention relates to the use of one or more antimicrobial metals preferably selected from silver, gold, platinum, and palladium but most preferably silver, formed with atomic disorder, and preferably in a nanocrystalline form, for reducing inflammation or infection of the mucosal membrane. The antimicrobial metal may be formulated as, or used in the form of, a nanocrystalline coating of one or more antimicrobial or noble metals, a nanocrystalline powder of one or more antimicrobial or noble metals, or a liquid or solution containing dissolved species from a nanocrystalline powder or coating of one or more antimicrobial or noble metals.Type: GrantFiled: April 23, 2002Date of Patent: August 8, 2006Assignee: Nucryst Pharmaceuticals Corp.Inventors: Robert Edward Burrell, Antony George Naylor, Peter Howard Moxham
-
Patent number: 7078021Abstract: Dental products such as toothpastes, mouthwash and dental floss are disclosed which products are enhanced by having dissolved, dispersed or coated thereon a compound which promoted bone growth. Preferred compounds are peptide sequences comprising 10 to 50 amino acids are disclosed. The sequences are characterized by containing an integrin binding motif such as RGD sequence and the remainder of amino acids contiguous with the RGD sequence in matrix extracellular phosphoglycoprotein. The sequences may be formulated for dispersed in toothpaste or a mouthwash and administered to enhance bone/tooth growth. When the dental products are used repeatedly over time they enhance good dental health.Type: GrantFiled: August 9, 2001Date of Patent: July 18, 2006Assignee: Acologix, Inc.Inventors: Toshiyuki Yoneda, Motoyoshi Nomizu, Yoshinari Kumagai
-
Patent number: 7078059Abstract: The invention provides a method for enhancing bone formation, inhibiting osteoclastic differentiation and/or activating osteoblastic differentiation whereby to manage, treat or achieve prophylaxis of bone disease which comprises administering to a human or animal subject suffering from, or susceptible to bone disease a therapeutically or prophylactically effective amount of a lanthanum compound.Type: GrantFiled: June 26, 2001Date of Patent: July 18, 2006Assignee: Shire Holdings AGInventors: Nigel D. Atherton, Joseph William Totten, Michael David Gaitonde
-
Patent number: 7048910Abstract: The invention relates to the use of one or more compounds selected from compounds of formulae Ia and Ib, the physiologically compatible salts of compounds of formula Ia and Ib and the stereoisomer forms of compounds of formula La and Ib, wherein R1, R2, R3, R4 and n have the meaning cited in claim 1.Type: GrantFiled: August 8, 2001Date of Patent: May 23, 2006Assignee: Merck Patent GmbHInventors: Joachim Buenger, Hansjuergen Driller, Olaf den Hollander
-
Patent number: 7029690Abstract: Disclosed are articles and oral compositions which enable positioning material(s) which absorb oral fluids into controlled, direct contact with at least one dental arch, or portion thereof, of a subject at the location where teeth emerge from dental arch gum tissue, in a manner conducive to increasing crevicular fluid flow while maintaining a relatively dry application field for a therapeutic and/or cosmetic result effecting period of time. The method is applicable to introduction of gingivally absorbed substances and to treatment of, for instance, periodontal gum disease wherein bacteria is swept along in the crevicular fluid and lysed.Type: GrantFiled: November 4, 2002Date of Patent: April 18, 2006Assignee: Clinically Clean Inc.Inventor: Janet M. Wehrli
-
Patent number: 6919070Abstract: A stomatic composition has particles of hydroxyapatite with an average particle size in length (l), width (d) and thickness (h) of: l from 0.2 ?m to about 0.01 ?m, d from about 0.1 ?m to about 0.001 ?m and h from about 0.1 ?m to about 0.001 ?m.Type: GrantFiled: October 17, 1997Date of Patent: July 19, 2005Assignee: Zakrytoe Aktsionernoe Obschestvo “OSTIM”Inventors: Vsevolod Nikolaevich Rudin, Vladislav Petrovich Zuev, Vladimir Fedorovich Komarov, Igor Vitallevich Melikhov, Vladimir Vasillevich Minaev, Andrei Yurlevich Orlov, Anatoly Aleksandrovich Mishin, Viktor Evgenievich Bozhevolnov
-
Patent number: 6902738Abstract: Topical oral dosage forms containing bismuth compounds are described, which are useful for treating H. pylori and other bacterial infections that cause gastrointestinal disorders and halitosis, as well as for treating ocular and dermal wounds. Methods of employing topical oral dosage forms for treating bacterial infections that cause gastrointestinal disorders and halitosis, and for treating ocular and dermal wounds, are also described.Type: GrantFiled: March 19, 2002Date of Patent: June 7, 2005Assignee: Josman Laboratories, Inc.Inventors: Scott A. Gubler, Narayan K. Athanikar
-
Patent number: 6818224Abstract: A method is described for preparing a fluid pharmaceutical composition which allows the controlled release of at least one active substance. The method involves mixing a therapeutically effective amount of at least one active substance, from 3 to 55% by weight of phospholipid, from 16 to 72% by weight of pharmaceutically acceptable solvent, and from 4 to 52% by weight of fatty acid. The composition has a property of gelling instantaneously in the presence of an aqueous phase.Type: GrantFiled: September 17, 2002Date of Patent: November 16, 2004Assignee: UCB, S.A.Inventors: Domenico Fanara, Henri Vranckx, Michel Deleers, Pierre Grognet
-
Patent number: 6770268Abstract: A non-foaming periodontic composition in a gel form or mouth wash for treating gum diseases or used in bleaching teeth which are alcohol free. The composition is a mixture of an isoalkyl amine oxide and an antimicrobial betaine compound. The composition is useful for treating gum disease and whitening teeth.Type: GrantFiled: May 21, 2003Date of Patent: August 3, 2004Assignee: Oratec Corp.Inventors: Dave Hall, James R. Hunt
-
Patent number: 6669931Abstract: A method of treating dental carries and remineralizing lesions includes the steps of directing a stream of oxidizing gas onto a carious lesions for a period of time sufficient to kill microorganisms within the carious lesion; and thereafter applying to the lesion a remineralization formulation.Type: GrantFiled: March 13, 2002Date of Patent: December 30, 2003Assignee: Curozone Ireland LimitedInventors: Edward Lynch, Jurgen Schemmer
-
Patent number: 6670343Abstract: An agent for periodontal disease includes, as an active component, a methanebisphosphonic acid derivative or a hydrate thereof represented by the general formula (I): [wherein X, Y, m, n, The methanebisphosphonic acid derivative represented by the general formula (I) or a hydrate thereof according to the present invention has activities such as inhibitory effect on cell infiltration to the affected part associated with periodontal disease, and is useful for the prophylaxis or treatment of periodontal disease.Type: GrantFiled: May 29, 2001Date of Patent: December 30, 2003Assignee: Toray Industries, Inc.Inventors: Masatoshi Ito, Seiji Okazaki, Yuriko Kawai, Norio Kawabe
-
Patent number: 6649148Abstract: A reductant rinse including xylitol prevents buildup in ozone carrying lines in apparatus for the treatment of dental caries.Type: GrantFiled: March 12, 2002Date of Patent: November 18, 2003Assignee: Curozone Ireland LimitedInventors: Edward Lynch, Jurgen Schemmer
-
Patent number: 6605268Abstract: Provided with a tooth paste composition which contains an abrasive cleaning agent, a humectant, a binder or thickener and a flavouring agent, the tooth paste, and includes a rose-seed oil, wherein the rose-seed oil is contained in an amount of 1-6% by weight based on the total weight of the tooth paste composition.Type: GrantFiled: September 12, 2001Date of Patent: August 12, 2003Inventor: Myung Woo Jung
-
Patent number: 6589511Abstract: The composition for forming solid particles of the present invention comprises a biodegradable polymer, a solvent, a polyhydric alcohol, a viscosity-increasing agent, and an active drug, wherein the composition is in the form of an emulsion comprising a continuous phase rich in the polyhydric alcohol and the viscosity-increasing agent and a dispersed phase of liquid particles rich in the biodegradable polymer and the solvent, the dispersed phase being present in said continuous phase. The above composition can allow the carrier comprising an active drug to reach all corners of narrow periodontal pockets, and the carrier comprising the active drug has high retention in the periodontal pockets, whereby making it possible to maintain the active drug for a long period of time at a high concentration.Type: GrantFiled: September 17, 1999Date of Patent: July 8, 2003Assignee: Sunstar, Inc.Inventor: Yasumitsu Shimizu
-
Patent number: 6576226Abstract: The present invention relates to compositions and methods of treating periodontal disease and related disorders utilizing a sustained, controlled release targeted delivery method to effectively disrupt and inhibit bacterial biofilms at periodontal treatment sites.Type: GrantFiled: November 17, 2000Date of Patent: June 10, 2003Inventor: Gary R. Jernberg
-
Patent number: 6544498Abstract: A periodontal disease preventive and ameliorative agent with milk-derived basic protein as its effective ingredient, which protein is obtained by contacting a milk or milk-derived ingredient with cation-exchange resin, and then eluting a fraction adsorbed by the resin using an elution solution and which protein has an isoelectric point within a range of 7.5˜11, and food/drink and a medicament such as toothpaste and gargling agents, which contain this periodontal disease preventive and ameliorative agent.Type: GrantFiled: March 20, 2000Date of Patent: April 8, 2003Assignee: Snow Brand Milk Products Co., Ltd.Inventors: Yukihiro Takada, Seiichirou Aoe, Atsusi Serizawa, Toshiaki Suguri, Shunichi Dousako
-
Patent number: 6528038Abstract: The present invention provides a composition for use in raising an immune response directed against Porphyromonas gingivalis. The composition includes a suitable adjuvant and/or acceptable carrier and one substantially purified P. gingivalis immunogen. The immunogen is selected from the group consisting of Antigen 1, Antigen 2, Antigen 3, Antigen 4 and epitope containing fragments thereof, in which: Antigen 1 is an antigen of P. gingivalis and has an internal amino acid sequence:DLENKGEATLLVTFGSSYKAPRETYAKIEKTFAAAYPDQR; Antigen 2 is an antigen of P. gingivalis and has an internal amino acid sequence: DNPDENPLEGDITQTHTEKYVLAED; Antigen 3 is an antigen of P. gingivalis and has an internal amino acid sequence: DVLLLDVTPLSLGIETMGGVMTYLIDANTTIPKLK; Antigen 4 is an antigen of P. gingivalis and has an internal amino acid sequence: VYNASISAVGNTSAIDPVVQIIHHN.Type: GrantFiled: July 7, 1998Date of Patent: March 4, 2003Assignee: The University of MelbourneInventors: Eric Charles Reynolds, Nada Slakeski, Anne Hendtlass
-
Patent number: 6471970Abstract: A method is described for preparing a fluid pharmaceutical composition which allows the controlled release of at least one active substance. The method involves mixing a therapeutically effective amount of at least one active substance, from 3 to 55% by weight of phospholipid, from 16 to 72% by weight of pharmaceutically acceptable solvent, and from 4 to 52 % by weight of fatty acid. The composition has a property of gelling instantaneously in the presence of an aqueous phase.Type: GrantFiled: October 27, 2000Date of Patent: October 29, 2002Assignee: UCB, S.A.Inventors: Domenico Fanara, Henri Vranckx, Michel Deleers, Pierre Grognet
-
Patent number: 6426085Abstract: This invention provides for a method for treatment of corneal and dermal wounds by administering bismuth compounds in topical dosage forms. Bismuth compounds cause stimulation of release of growth factors in damaged tissue to promote regeneration of epithelial cells and hence accelerate wound healing. These bismuth compounds also have good antimicrobial activity against several anaerobic bacteria involved in diaper rash exacerbation.Type: GrantFiled: May 24, 2000Date of Patent: July 30, 2002Assignee: Josman Laboratories Inc.Inventor: Narayan K. Athanikar
-
Patent number: 6423300Abstract: The present invention relates to an oral composition containing a zinc compound containing free available zinc ion and at least one stabilized or stable Eh raising compound distributed in an oral vehicle. The present invention further relates to a method of inhibiting the formation of sulfur containing anions and preventing a reduction in the Eh of the oral cavity. A method of reducing oral malodor and gingivitis and periodontitis is also provided by this invention.Type: GrantFiled: February 17, 2000Date of Patent: July 23, 2002Assignee: The Research Foundation of State University of New YorkInventors: Israel Kleinberg, Milroy Codipilly
-
Patent number: 6344214Abstract: Astaxanthin is a potent antioxidant, over 500 times more powerful than Vitamin E and 10 times stronger than other carotenoids such as zeaxanthin, lutein, canthaxanthin and beta-carotene. Astaxanthin has also been shown to enhance and modulate the immune system and diminish the damaging effects of UVA sunlight. Disclosed is a method for retarding and ameliorating fever blisters (cold sores) and canker sores. The method comprises administering a source of astaxanthin in a therapeutically effective amount to prevent, retard and ameliorate fever blisters and canker sores. The astaxanthin may be administered orally, topically, or in a combination of oral and topical dosage.Type: GrantFiled: December 13, 1999Date of Patent: February 5, 2002Assignee: Cyanotech CorporationInventor: R. Todd Lorenz
-
Patent number: 6340455Abstract: Skin prick test for the determination of the predisposition of an individual to develop marginal periodontitis, said kit comprising: (a) a first reagent containing a known quantity of a surface structure common to anaerobic Gram negative pathogens which is capable of triggering the inflammatory response associated with periodontitis and gingivitis; (b) second reagent containing an agonist to said individual; (c) a negative control; and (d) instructions for the use of said kit; and a method for such determination of predisposition.Type: GrantFiled: June 23, 1999Date of Patent: January 22, 2002Assignee: Peridoc ABInventors: Leif Blomlöf, Sven Lindskog, Olle Zetterström
-
Patent number: 6325991Abstract: The present invention relates to methods of treating periodontal disease in a mammal. The methods include administering to an animal an s effective amount of an inhibitor of sPLA2. The inhibitors may be advantageously delivered as a composition that includes various carriers. In certain aspects of the invention, inhibitors used in the method include substituted indole or substituted pyrrole sPLA2 inhibitors. Also provided are compositions that include the sPLA2 carriers for oral delivery of the inhibitors.Type: GrantFiled: August 24, 1999Date of Patent: December 4, 2001Inventor: Susan E. Draheim
-
Patent number: 6280775Abstract: This invention provides a liquid antimicrobial composition that is particularly useful as a mouthwash for treating or reducing the risk of dental disease. The composition is prepared by mixing a first solution comprising a water soluble metal chlorite compound with a second solution comprising sodium persulfate and hydrogen peroxide. The resulting composition, containing chlorine dioxide, is preferably used at the time of preparation by applying the composition to the locus where treatment is desired.Type: GrantFiled: May 19, 2000Date of Patent: August 28, 2001Inventors: Joseph Alan Sasson, Riccardo Panicucci
-
Patent number: 6264966Abstract: This invention involves the use of a class of compounds with chelation affinity and selectivity for first transition series elements. Application or administration of the free or conjugated compound, or physiological salts of the free or conjugated compound, results in decrease of the bioavailability and/or chemical action of first transition series elements. These characteristics make such compounds useful in cosmetics and personal care products to decrease odor arising from microbial growth on body surfaces and in body cavities, decrease microbial growth on teeth, plaque, and gums that cause tooth decay and gum disease, inhibition of oxidative damage to the skin, inhibition of enzymatic action of metalloenzymes dependent on first transition series elements, and inhibition of reperfusion injury.Type: GrantFiled: February 22, 2000Date of Patent: July 24, 2001Assignee: Concat, Ltd.Inventors: Harry S. Winchell, Joseph Y. Klein, Elliot D. Simhon, Rosa L. Cyjon, Ofer Klein, Haim Zaklad
-
Patent number: 6261597Abstract: A method of improving the periodontal condition of a person is disclosed. A suspension of small, unilamellar vesicles composed primarily of phospholipids, similar in nature to those of egg phosphatidylcholine, is administered parenterally to a person suffering from periodontal disease. In the method, liposomes are infused over an extended period of time of at least several weeks, until a desired improvement in gum condition is achieved.Type: GrantFiled: December 3, 1999Date of Patent: July 17, 2001Inventor: Seymour J. Kurtz
-
Patent number: 6251419Abstract: The invention relates to a membrane system for controlled tissue regeneration of the periodontium, comprising a resorbable polymer membrane and anti-adhesion molecules.Type: GrantFiled: January 5, 2000Date of Patent: June 26, 2001Inventors: Hans Georg Graber, Friedrich Lampert
-
Patent number: 6248309Abstract: Gum compositions containing effective amounts of antimicrobial agents that are released to the oral cavity during chewing. In specific embodiments, the antimicrobial agents are released from the gum at different rates and times.Type: GrantFiled: August 19, 1999Date of Patent: June 19, 2001Assignee: Optiva CorporationInventors: Lokanathan M. Iyer, Dawn E. Barkans, Brian D. Hench
-
Patent number: 6228347Abstract: A gel, paste, gum or lozenge composition for oral application to human gums to prevent and reduce symptoms of gum disease. The composition includes reduced glutathione and a source of selenium.Type: GrantFiled: September 29, 1998Date of Patent: May 8, 2001Assignee: Thione International, Inc.Inventor: Theodore Hersh