Abstract: The present invention relates to a peptide with anti-inflammatory activity, wherein the peptide comprises at least one amino acid sequence among SEQ ID NO: 2 to SEQ ID NO: 179, the peptide has above 80% homology of amino acid sequence with above-mentioned sequences, or the peptide is the fragment of the above-mentioned peptides. The present invention also relates to an inflammatory composition comprising the above mentioned peptides. According to the present invention, the peptides that have at least one amino acid sequence of SEQ ID NO: 2 to SEQ ID NO: 179 shows outstanding efficacy in both suppressing inflammation and in prophylactic means. Therefore, the composition comprising the peptides of this invention can be used as anti-inflammatory pharmaceutical compositions or as cosmetic compositions, in turn, treating and preventing a variety of different types of inflammatory diseases.

Abstract: The present invention describes peptides which inhibit fusion of an arenavirus (e.g., Pichinde virus; PICV) with a host cell membrane. The arenavirus inhibiting (AVI) peptides described herein comprise a segment of the GP2 protein of an arenavirus. The AVI peptides are useful for inhibiting arenavirus-to-host cell membrane fusion and for treating arenavirus infections. In a particular embodiment, the arenavirus inhibiting peptide comprises a segment of PICV glycoprotein 2 (PICV GP2; SEQ ID NO: 1), Tamiami virus (TAMV) GP2 (SEQ ID NO: 14), or Lassa virus (LASV) GP2 (SEQ ID NO: 15). In particular, the segment is selected from a region of an arenavirus GP2 extending from the N-terminus into the first half of the FIR (i.e., from residues 1 through 105 of SEQ ID NO: 1, SEQ ID NO: 14, or SEQ ID NO: 15).

Abstract: There is provided a novel series of analogues of glucose-dependent insulinotropic polypeptide compounds, pharmaceutical compositions containing said compounds, and the use of said compounds as GIP-receptor agonists or antagonists for treatment of GIP-receptor mediated conditions, such as non-insulin dependent diabetes mellitus and obesity.

Abstract: Described herein is the identification of primate-specific glial cell line-derived neurotrophic factor opposite strand (GDNFOS) transcripts and encoded peptides. In particular embodiments, provided herein are three GDNFOS antisense transcripts, referred to as GDNFOS-1, GDNFOS-2 and GDNFOS-3. The GDNFOS-3 transcript encodes an ORF of 105 amino acids. Compositions comprising the GDNFOS transcripts and peptides are also provided by the present disclosure. Further provided are methods of treating a neurodegenerative or peripheral organ disease in a subject by administering a therapeutically effective amount of the disclosed GDNFOS nucleic acid molecules, peptides or compositions.

Abstract: The present invention relates to the use of antisecretory factors, such as antisecretory proteins, homologues, derivatives and/or fragments thereof having antisecretory activity, for the manufacture of a pharmaceutical composition for use in the treatment and/or prevention of intraocular hypertension. The invention thus relates to the use of pharmaceutical compositions comprising antisecretory factors in the treatment and/or prevention of intraocular hypertension, which is preferably characterized by hampered outflow of body fluid resulting in elevated pressure in the eye. The invention provides for a novel approach for treating and/or preventing such a condition turning the intraocular pressure to an acceptable level, optionally 21 mm Hg, or less.

Abstract: The present application is related to a modified protein comprising a protein having a coiled coil domain and a peptide having the sequence such as shown in SEQ ID NO 1: ZXBBBBZ that is linked to the coiled coil domain wherein: Z is any amino acid or is absent; X is any amino acid; B is an arginine (R) or a lysine (K). Said modified protein is in particular an antigen or a carrier protein, associated to an antigen. This modified protein has an increased affinity for negatively charged polymers such as nucleic acids or heparin, and shows an increased immunogenicity.

Abstract: A leucine zipper variant, a polynucleotide encoding the leucine zipper variant, a method of preparing a leucine zipper variant, a method of inhibiting HDM2- and/or HDMX using the leucine zipper variant, and a method of the prevention and/or treatment of cancer using the leucine zipper variant.

Abstract: The invention provides, inter alia, conjugates of a hydratable polymer (such as PEG, polyethylene glycol) and a lectin (such as wheat germ agglutinin, WGA), compositions comprising these conjugates, as well as methods and targeted uses of these conjugates and compositions for, e.g., lubricating, maintaining hydration of rehydrating, and/or inhibiting microorganism colonization of a biological surface in need thereof.

Abstract: The present invention relates to a means of controlling infection persistence of Helicobacter pylori (H. pylori). In particular, the present invention relates to an isolated, genetically modified Helicobacter pylori comprising a functional urease, wherein the contiguous amino acid sequence between amino acid 529 and amino acid 555 of SEQ ID NO:1 is altered to produce said modified Helicobacter pylori which is unable to establish or maintain a persistent infection.

Abstract: The invention relates to kinase ligands and polyligands. In particular, the invention relates to ligands, homopolyligands, and heteropolyligands that modulate protein kinase D (PKD) activity. The ligands and polyligands are utilized as research tools or as therapeutics. The invention includes linkage of the ligands and polyligands to cellular localization signals, epitope tags and/or reporters. The invention also includes polynucleotides encoding the ligands and polyligands.

Abstract: Disclosed are methods and compositions relating to plasmin inhibition.

Abstract: The present invention relates to Huwentoxin-IV variants, polynucleotides encoding them, methods of making and using the foregoing, and methods of alleviating pain with peptide inhibitors of Nav1.7.

Abstract: The present invention provides immunosuppression compounds to inhibit the programmed cell death 1 (PD1) signalling pathway. The present invention further provides peptide based compositions for treatment of cancer or treatment of infections via immunopotentiation caused by inhibition of immunosuppressive signaling induced by PD-1, PD-L1, or PD-L2 and therapies using them, immunopotentiative substrates included as the active ingredient. Further, the invention provides an application of the compositions containing the peptide moieties for preventive and/or therapeutic agents for cancer, cancer metastasis, immunodeficiency, an infectious disease or the like and an application of peptide moieties as a testing or diagnostic agent or a research agent for such a disease.

Abstract: The present invention relates to a method for pest management using inhibitory repeat domain IRD 9 (Seq ID No.2) proteinase inhibitor showing enhanced inhibitory activity against the gut proteases of insects. More particularly, the present invention relates to a IRD 9 (Seq ID No.2) proteinase inhibitor from non-host plant Capsicum annuum, which possesses significantly high insect protease inhibition activity against the gut proteases of Helicoverpa armigera.

Abstract: Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include amino acid sequences, and variants and fragments thereof, for novel variants of antipathogenic polypeptides generated through DNA shuffling that exhibit improved antipathogenic activity. Polynucleotides that encode the antipathogenic polypeptides are also provided. A method for inducing pathogen resistance in a plant using the polynucleotides disclosed herein is further provided. Compositions comprising an antipathogenic polypeptide or a microorganism comprising an antipathogenic polynucleotide of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Plants, plant cells, seeds, and microorganisms comprising an antipathogenic polynucleotide or polypeptide of the invention are also disclosed.

Abstract: The invention relates to toxin peptides capable of selectively inhibiting a Kv1.3 potassium channel protein. The toxin peptides of the invention are modified anuroctonus scorpion toxin peptides.

Abstract: The present invention relates to the field of protein expression. More specifically, the present invention provides compositions and methods for increasing the expression and signaling of proteins on cell surfaces. In particular embodiments, the present invention provides nucleic acids and amino acid sequences useful for improving/increasing protein expression on the cell surface. In several embodiments, the sequences are operably linked to the N-terminal end of the protein of interest. The nucleic acid sequence encoding the sequence tag and the protein comprise part of an expression vector. The protein is expressed with the N-terminal sequence tag. In certain embodiments, the sequences of the present invention can be used with one or more chaperone or accessory proteins. In particular embodiments, the one or more chaperone/accessory proteins are encoded by the same vector or separate vectors.

Abstract: The present invention provides poly(amide) polymers, polyconjugates, compositions and methods for the delivery of oligonucleotides for therapeutic purposes.

Abstract: The present invention relates to peptides, derivatives and analogs comprising an amino acid sequence derived from the transmembrane domain of HIV gp41 protein, pharmaceutical compositions comprising same, and uses thereof for therapy of inflammatory diseases and disorders, such as T-cell and/or monocyte mediated diseases.

Abstract: Novel isolated peptides which induce analgesia and which inhibit ASIC channels (Acid Sensing Ion Channels), to the polynucleotides encoding these peptides, and also to the pharmaceutical compositions, host cells, and vectors comprising these peptides and the polynucleotides encoding these peptides. In particular, these peptides are isolated from the venom of the snake Dendroaspis polylepis. The present invention also relates to the use of these peptides as a diagnostic tool or as a medicament, particularly as an analgesic, or for identifying analgesic molecules or molecules which inhibit ASIC channels.

Abstract: The present disclosure provides methods for detecting a tumor microenvironment, a peritumoral tissue, or a portion thereof using a chlorotoxin conjugate. Also provided are chlorotoxin peptides and variants thereof conjugated to a detectable label for use in detecting a tumor microenvironment, a peritumoral tissue, or a portion thereof.

Abstract: The present invention refers to methods for selectively recognizing a base pair in a DNA sequence by a polypeptide, to modified polypeptides which specifically recognize one or more base pairs in a DNA sequence and, to DNA which is modified so that it can be specifically recognized by a polypeptide and to uses of the polypeptide and DNA in specific DNA targeting as well as to methods of modulating expression of target genes in a cell.

Abstract: The invention provides compositions and methods relating to bioactive peptide analogs of PEDF.

Abstract: Compositions, methods, systems, apparatus and/or articles of manufacture are disclosed for reducing the susceptibility of a population and/or members thereof to cancer, which may include anti-cancer vaccines, components thereof which may include novopeptides, and methods relating thereto.

Abstract: A peptide having antibacterial or anti-inflammatory activity and a pharmaceutical composition containing the same as an active ingredient are described. Also, a peptide having antibacterial or anti-inflammatory activity against dental bacteria, including periodontal pathogens, and bacteria causing atopic dermatitis, and a pharmaceutical composition containing the peptide as an active ingredient are described. The inventive peptide having antibacterial or anti-inflammatory activity can be used for the treatment of both dental infectious diseases, including periodontitis, and inflammations, including arthritis.

Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.

Abstract: JNK inhibitor molecules are described. In addition, methods for raising antibodies against such JNK inhibitor molecules are disclosed. These antibodies and cells producing these antibodies are also described.

Abstract: A method for regulating Src and its downstream signaling pathway which includes binding between Src and Na+/K+-ATPase is disclosed. The Na+/K+-ATPase/Src complex is a functional receptor for cardiotonic steroids such as ouabain. Also disclosed are Src inhibitors or activators which include either Na+/K+-ATPase or Src that interfere with the interaction between the Na/K-ATPase and Src, act via a different mechanism from ATP analogs, and is pathway (Na+/K+-ATPase) specific.

Abstract: The present invention provides a synthetic peptide molecule that specifically binds an FXYD2-gamma isoform of pancreatic beta cells, said synthetic peptide molecule has 25 amino acids.

Abstract: Peptides are provided having leptin receptor agonist activity. The peptides are useful for treating obesity, type II diabetes, appetite control after bariatric surgery, insulin resistance, lipodystrophy and hypothalamic amenorrhea, obesity-related infertility, among other diseases and conditions related to leptin deficiency and/or leptin resistance.

Abstract: The invention provides Ehrlichia canis antigens that can be used to detect E. canis infected animals regardless of whether the animals have been vaccinated for E. canis. The invention also provides compositions and methods for determining the presence of E. canis antigens and antibodies.

Abstract: Glucagon antagonists are provided which comprise amino acid substitutions and/or chemical modifications to glucagon sequence. In one embodiment, the glucagon antagonists comprise a native glucagon peptide that has been modified by the deletion of the first two to five amino acid residues from the N-terminus and (i) an amino acid substitution at position 9 (according to the numbering of native glucagon) or (ii) substitution of the Phe at position 6 (according to the numbering of native glucagon) with phenyl lactic acid (PLA). In another embodiment, the glucagon antagonists comprise the structure A-B-C as described herein, wherein A is PLA, an oxy derivative thereof, or a peptide of 2-6 amino acids in which two consecutive amino acids of the peptide are linked via an ester or ether bond.

Abstract: A lipid membrane structure for delivering a substance into a nucleus of a cell, wherein lipid membrane is modified with (a) a polypeptide comprising the amino acid sequence of SEQ ID NO: 1, and/or (b) a polypeptide consisting of an amino acid sequence comprising the amino acid sequence of SEQ ID NO: 1, but including deletion and/or substitution and/or insertion of one or several amino acid residues, and having an activity of promoting migration of the lipid membrane structure into a nucleus of a cell, which can efficiently deliver a nucleic acid into a nucleus of an immunocyte such as dendritic cell.

Abstract: Glucagon analogs are disclosed that exhibit both glucagon antagonist and GLP-1 agonist activity. In one embodiment, the glucagon antagonist/GLP-1 agonist comprises a modified amino acid sequence of native glucagon, in which the first one to five N-terminal amino acids of native glucagon is deleted and in which the alpha helix is stabilized.

Abstract: Disclosed are compositions and methods for modulating Dpy-30 binding activity. The compositions may include peptides or peptidomimetics thereof that are related to RSP3 or Ash2L and that bind to Dpy-30.

Abstract: The present invention relates to polypeptides and their uses as apelin inhibitors. More particularly, the present invention relates to a polypeptide comprising the sequence as set forth in SEQ ID NO:1 wherein at least one arginine residue at position 18, 19, 22 or 23 has been substituted or deleted.

Abstract: The present invention relates to a novel protein skeletal module which increases the binding affinity or binding specificity of active polypeptides. More particularly, the present invention relates to a protein skeletal module comprising polypeptides consisting of the 1st to 19th amino acids of the amino acid sequence expressed in sequence number 1; polypeptides comprising active polypeptides; and polypeptides consisting of the 29th to 86th amino acids of the amino acid sequence expressed in sequence number 1. The present invention also relates to a method for preparing the protein skeletal module. The protein skeletal module of the present invention increases the binding affinity or binding specificity of active polypeptides embedded therein, and therefore is effective in diagnosing and treating diseases.

Abstract: The present invention provides therapeutic agents and methods for treating cancer using the polypeptides composed of an amino acid sequence which includes a polypeptide fragment of DEPDC1. The polypeptides of the present invention can be introduced into cancer cells by modifying the polypeptides with transfection agents such as poly-arginine. Furthermore, the present invention provides methods of screening for therapeutic agents or compounds useful in inhibition of the DEPDC1/ZN-F224 complex formation or the treatment of cancer. The present invention also provides siRNAs targeting the ZNF224 gene, which are suggested to be useful in the treatment of bladder cancer.

Abstract: The present invention relates to novel melanoma antigen peptides and specific T lymphocytes directed to said peptides and the use thereof for treating melanoma.

Abstract: The present invention provides nucleic acids and peptides, and methods of using the nucleic acids and peptides to identify subjects at risk for a TDP-43 proteinopathy. The invention also provides for an array comprising the nucleic acids and peptides of the invention.

Abstract: The present invention provides reagents and methods for treating dental disease.

Abstract: Labelled polypeptide constituted by: (i) a peptide fragment of 38 to 50 amino acids including a peptide of sequence SEQ ID NO: 1, and (ii) a label selected from the group constituted by radioactive groups, non-protein fluorophors, protein fluorophors, magnetic particles or a paramagnetic spin label, in order that when the label is a fluorophor protein, the labelled polypeptide further contains a peptide spacer of 3 to 15 amino acids, located between the peptide fragment and the label and use thereof as a diagnostic tool.

Abstract: The present invention relates to various soluble forms of CD31, including a novel form which is shed by activated platelets and released into the circulation. Methods for detecting said soluble forms of CD31 are disclosed, as are methods of specifically 1 detecting said platelet-derived shed CD31 and the use of such methods as a diagnostic tool.

Abstract: A method of bioassay for the quantification of peptide fragments relevant to neurodegenerative conditions comprising a neo-epitope formed by cleavage of a Tau protein by a secretase such as ADAM10 comprises contacting a blood derived sample with an antibody specific for the neo-epitope and determining the level of binding of said immunological binding partner to peptide fragments in said sample. Neo-epitope containing peptide levels are found to be inversely correlated to cognitive function.

Abstract: The invention provides carriers that enhance the absorption, half-life or bioavailability of Ghrelin peptides. The carriers comprise targeting groups that bind the Vitamin D Binding protein (DBP), conjugation groups for coupling the targeting groups to the therapeutic compounds, and optionally scaffolding moieties.

Abstract: Modified glucagon peptides are disclosed having enhanced potency at the glucagon receptor relative to native glucagon. Further modification of the glucagon peptides by forming intramolecular bridges or the substitution of the terminal carboxylic acid with an amide group produces peptides exhibiting glucagon/GLP-1 receptor co-agonist activity. The solubility and stability of these high potency glucagon analogs can be further improved by modification of the polypeptides by pegylation, acylation, alkylation, substitution of carboxy terminal amino acids, C-terminal truncation, or the addition of a carboxy terminal peptide selected from the group consisting of SEQ ID NO: 26 (GPSSGAPPPS), SEQ ID NO: 27 (KRNRNNIA) and SEQ ID NO: 28 (KRNR).

Abstract: The present invention is related to peptides that can be used to reduce the immune response against FVIII or to induce tolerance to human FVIII in patients with, e.g., hemophilia A. Furthermore, the peptides can be used for immunodiagnostic purposes to detect FVIII-specific CD4+ T cells to monitor patients with hemophilia A during replacement therapy and during immune tolerance induction therapy.

Abstract: The present invention is directed to methods for administering antigenic material to a patient as a vaccine against an infection comprising providing both an antigenic material specific to the desired immunological response desired plus an adjuvant comprised of a peptide of a sequence derived from the sequence of pneumococcal surface adhesin A protein (PsaA). Preferably the peptide comprises a sequences derived from one or more sequences of PsaA that contain the epitope regions or contiguous amino acids of SEQ ID NOs 1 or 2. The invention is also directed to vaccine compositions containing adjuvant of the invention and also adjuvant compositions of the invention.

Abstract: The present invention relates to a prodrug or a pharmaceutically acceptable salt thereof comprising a drug linker conjugate D-L, wherein -D is an amine containing biologically active moiety; and -L is a non-biologically active linker moiety -L1 represented by formula (I): wherein the dashed line indicates the attachment to the amine of the biologically active moiety and wherein R1, R1a, R2, R2a, R3, R3a, X, X1, X2, X3 have the meaning as indicated in the description and the claims and wherein L1 is substituted with one to four groups L2-Z and optionally further substituted, provided that the hydrogen marked with the asterisk in formula (I) is not replaced by a substituent; wherein L2 is a single chemical bond or a spacer; and Z is a carrier group. The invention also relates to A-L, wherein A is a leaving group, pharmaceutical composition comprising said prodrugs and their use as medicaments.

Abstract: Engineered transcriptional activator-like effectors (TALEs) are versatile tools for genome manipulation with applications in research and clinical contexts. One current drawback of TALEs is their tendency to bind and cleave off-target sequence, which hampers their clinical application and renders applications requiring high-fidelity binding unfeasible. This disclosure provides engineered TALE domains and TALEs comprising such engineered domains, e.g., TALE nucleases (TALENs), TALE transcriptional activators, TALE transcriptional repressors, and TALE epigenetic modification enzymes, with improved specificity and methods for generating and using such TALEs.