Abstract: A cell-penetrating peptide of (A) to (D) below gives cell membrane permeability and transmucosal absorbability to a physiologically active substance: (A) a peptide having the amino acid sequence of SEQ ID NO:1; (B) a peptide represented by SEQ ID NO:1 except that one or several basic amino acids are changed; (C) a peptide represented by SEQ ID NO:1 except that 1 to 5 amino acids are changed; (D) a peptide having: the reverse sequence of any of (A) to (C); an amino acid sequence which is the same as the reverse sequence of (A) except that one or several basic amino acids are changed; or an amino acid sequence which is the same as the reverse sequence of (A) except that 1 to 5 amino acids are changed.

Abstract: The invention is directed to a Ca2+ precipatable polypeptide tags and cassettes useful for purification of molecules from heterogeneous samples. The invention also relates to methods for bioseparation of molecules comprising Ca2+ precipatable tags and cassettes.

Abstract: The present invention discloses novel macromolecule transduction domain (MTD) peptides which facilitate the traverse of a biologically active molecule across the cell membrane. Also disclosed are polynucleotides encoding the MTD peptides, methods of identifying the MTD peptides; methods of genetically engineering a biologically active molecule to have cell permeability by using the MTD peptides, methods of importing a biologically active molecule into a cell by using the MTD peptides, and uses thereof.

Abstract: The present invention relates to compositions comprising peptides for preventing or treating allergy to house dust mites, and in particular to optimal combinations of peptides for preventing or treating said allergy.

Abstract: Peptide compounds of the general formula (I) R1-(AA)n-X1—X2-Arg-Glu-Met-Asn-Trp-X3-(AA)p-R2 modulating the survivin protein are described. Furthermore, cosmetic or pharmaceutical compositions, including at least one peptide of the general formula (I), in a physiologically acceptable medium are described. Additionally, methods for treating the cutaneous signs of ageing and photo-ageing, treating the skin against external aggressions, and limiting hair loss and/or stimulating hair growth are described.

Abstract: Disclosed is an isomer, enantiomer, diastereoisomer or tautomer of a compound represented by Formula I or II or a salt thereof, in which R1, R2, R3, R100, R200, R300, A, A1, BG, Q and Q1 are substituents described herein. Also disclosed is the use of compounds of Formula I and II to treat proliferative disorders such as cancer.

Abstract: The present invention provides stable metastin derivatives having excellent biological activities (a cancer metastasis suppressing activity, a cancer growth suppressing activity, a gonadotropic hormone secretion stimulating activity, sex hormone secretion stimulating activity, etc.). By substituting the constituent amino acids of metastin with specific amino acids, the metastin derivatives of the present invention achieve more improved blood stability, solubility, etc., reduced gelation tendency, improved pharmacokinetics, as well as exhibit an excellent cancer metastasis suppressing activity or a cancer growth suppressing activity. The metastin derivatives of the present invention also have a gonadotropic hormone secretion suppressing activity, sex hormone secretion suppressing activity, etc.

Abstract: The invention relates to antigen peptide derived from the Nectin4 and its use for preventing and treating cancer.

Abstract: A method for manufacturing at least one kind of eukaryotic cells or a biosynthetic substance derived from the eukaryotic cells by proliferating the cells, which includes preparing an artificially synthesized peptide for promoting proliferation of the at least one kind of eukaryotic cells, incubating the eukaryotic cells in a culture medium, and adding the synthesized peptide at least once to the culture medium during the incubation process. The synthesized peptide includes an amino acid sequence selected from SEQ ID NOS: 1 to 18, and an amino acid sequence selected from SEQ ID NOS: 19 to 97.

Abstract: As discussed in detail herein, isolated epitope peptides derived from SEMA5B bind to an HLA antigen and induce cytotoxic T lymphocytes (CTL) and thus are suitable for use in the context of cancer immunotherapy, more particularly cancer vaccines. The inventive peptides encompass both the above mentioned amino acid sequences and modified versions thereof, in which one, two, or several amino acids are substituted, deleted, inserted or added, provided such modified versions retain the requisite HLA binding and/or CTL inducibility of the original sequences. Further provided are polynucleotides encoding any of the aforementioned peptides as well pharmaceutical agents or compositions that include any of the aforementioned peptides or polynucleotides. The peptides, polynucleotides, pharmaceutical agents or compositions of this invention find particular utility in the treatment and/or prevention of cancers and tumors, including, for example, esophageal cancer, NSCLC, RCC and SCLC.

Abstract: The present invention relates to the use of compounds for producing a medicament for preventing and/or treating atherosclerosis, atherosclerosis risk diseases and atherosclerosis sequelae.

Abstract: Polypeptides labelled with a donor and acceptor pair of dyes selected from a dibenzorhodamine dye and a diamino-benzophenoxazine dye are peptide conjugates which are useful for intracellular and bead-based assays with fluorescence detection. Peptide conjugates with a caspase-recognition site undergo cleavage into peptide fragments which may be detected, located, and quantitated by the changes in fluorescence. Intracellular cleavage of peptide conjugates is correlated with apoptosis.

Abstract: Novel murine astroviruses, and methods of detecting the viruses are disclosed. Also disclosed are uses of the viruses and infected animals as model systems for discovery and development of vaccines and therapies for diseases caused by or associated with astrovirus infection, including human astrovirus-based diseases.

Abstract: The invention provides methods for identifying and optimizing peptide substrates for enzymes such as lipoic acid ligase (Lp1A).

Abstract: Disclosed are: a peptide comprising an amino acid sequence composed of contiguous nine amino acid residues derived from a WT1 protein, wherein an amino acid residue at position 2 in the amino acid sequence is selected from the group consisting of Ala, Ile, Leu, Val, Phe, Tyr, Ser and Asp and an amino acid residue at position 9 in the amino acid sequence is Arg; a polynucleotide encoding the peptide; a pharmaceutical composition comprising the peptide; and a method for the induction of a WT1-specific CTL using the peptide.

Abstract: The present invention provides peptides having an amino acid sequence as set forth in SEQ ID NO: 19, 22, 30, 34, 344, 358, 41, 44, 46, 48, 78, 376, 379, 80, 100, 101, 110, 111, 387, 112, 394, 114, 116, 117, 121, 395, 133, 135, 137, 426, 143, 147, 148, 149, 150, 152, 153, 154, 156, 160, 161, 162, 163, 166, 174, 178, 186, 194, 196, 202, 210, 213, 214, 217, 223, 227, 228, 233, 254, 271, 272 or 288, as well as peptides having the above-mentioned amino acid sequences in which 1, 2, or several (e.g., up to 5) amino acids are substituted, deleted, or added, provided the peptides possess cytotoxic T cell inducibility. The present invention also provides drugs for treating or preventing a disease associated with over-expression of the CDH3, EPHA4, ECT2, HIG2, INHBB, KIF20A, KNTC2, TTK and/or URLC10, e.g. cancers containing as an active ingredient one or more of these peptides. The peptides of the present invention find further utility as vaccines.

Abstract: The invention relates to a new identified mutation in the epidermal growth factor receptor gene, leading to an amino acidic change which highly correlates with the resistance to a therapy regimen comprising cetuximab and the sensitivity to a therapy regimen comprising panitumumab. The invention includes peptide sequences, primers and probes to detect such a mutation, as well as kits for predicting the response of a subject to a therapy regime comprising cetuximab and/or panitumumab. In particular, the invention is useful in the therapy regimen applicable to metastasic colorectal cancer and to head and neck cancer.

Abstract: Cellular targets on cancer cells have been identified that can be used with targeted molecular imaging to detect the cancer cells in vivo. Non-invasive methods for detecting cancer cells, such as metastasized cancer cells, are therefore provided. Also provided are compositions and kits for use in the disclosed methods.

Abstract: Provided is a novel cancer-treating agent which can be used as a novel choice for the treatment of cancer. Specifically provided are: a peptide that inhibits binding of ERAP1 polypeptide to PHB2 polypeptide, which comprises a binding site of the ERAP1 polypeptide to the PHB2 polypeptide, and a pharmaceutical composition comprising the peptide. In addition, provided is a method for screening a drug candidate for treating and/or preventing cancer using inhibition of the binding of the ERAP1 polypeptide to PP1? polypeptide, PKA polypeptide or PKB polypeptide as an index.

Abstract: This invention concerns affinity tools for oligomeric forms of tau protein. It relates to the field of neurodegeneration, more particularly to the field of tau-related diseases and tauopathy. The invention provides novel tau antibodies and antibody fragments, nucleic acids encoding such antibodies and antibody fragments, cell lines producing such antibodies and antibody fragments, antibody compositions, and kits for the detection of aggregated tau and for the diagnosis of diseases involving aggregated tau. The invention further provides methods for the detection of aggregated tau, for the diagnosis of diseases involving aggregated tau, and for the identification of compositions interfering with the formation and/or stability of tau aggregates.

Abstract: The present invention relates to stable compositions comprising linaclotide, as well as to various methods and processes for the preparation and use of the compositions.

Abstract: Protein kinase inhibitors and more specifically inhibitors of the protein kinase c-Jun amino terminal kinase are described. Additionally, JNK inhibitor sequences, chimeric peptides, nucleic acids encoding same as well as pharmaceutical compositions for treating pathophysiologies associated with JNK signaling are described.

Abstract: The present invention provides a peptide comprising an amino acid sequence that is part of the amino acid sequence of CDK4 protein, or homologous to part of the amino acid sequence of CDK4 protein, which peptide is cytotoxic to, and/or inhibiting to the growth of, a cancer cell and/or stimulating to the growth of a non-cancerous cell and/or a control cell. Methods of identifying such peptides and medical uses of such peptides are also disclosed.

Abstract: The present invention features isolated polypeptides that have bactericidal and angiogenic activities. The invention features isolated polypeptides comprising amino acid sequences of RNase A ribonucleases, fragments and variants thereof, pharmaceutical compositions, and methods for treatment of a subject.

Abstract: The present invention relates to stroke-targeting peptides and use thereof. More specifically, the present invention relates to a stroke-targeting peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4 and use thereof. The peptide of the present invention can be specifically bound to stroke cells in the subject, and thus can be effectively used in diagnostic markers and kits for stroke, and compositions for drug delivery specific to stroke and pharmaceutical compositions and compositions for imaging stroke.

Abstract: The invention provides a peptide comprising a human cytolytic T lymphocyte (CTL) epitope from the human tumor-associated antigen (TAA) New Gene Expressed in Prostate (NGEP), which can be used in vaccine prevention or therapy of prostate cancer, as well as a nucleic acid encoding the peptide, a vector comprising the nucleic acid, a cell comprising the peptide, nucleic acid, or vector, and compositions thereof.

Abstract: The present invention relates to targeting peptides capable of specifically binding to microbial organisms (e.g., P. aeruginosa or S. mutans), antimicrobial peptides having antimicrobial activities, and specifically/selectively targeted antimicrobial peptides (STAMPs). In addition, the present invention provides methods of selectively killing or inhibiting microbial organisms by using the peptides or compositions provided by the present invention.

Abstract: The present invention provides a compound including a peptidomimetic which interacts sterically with the binding site of a F11R molecule, the peptidomimetic including a peptidomimetic having the SEQ ID NO: 4D. The present invention also provides a method for treating a disorder comprising administering peptide 4D to a mammal.

Abstract: As discussed in greater detail herein, isolated epitope peptides derived from MPHOSPH1 bind to an HLA antigen and induce cytotoxic T lymphocytes (CTL) and thus are suitable for use in the context of cancer immunotherapy, more particularly cancer vaccines. The inventive peptides encompass both the above-mentioned MPHOSPH1-derived amino acid sequences and modified versions thereof, in which one, two, or several amino acids are substituted, deleted, inserted or added, provided such modified versions retain the requisite CTL inducibility of the original sequences. Further provided are polynucleotides encoding any of the aforementioned peptides as well as pharmaceutical agents or compositions that include any of the aforementioned peptides or polynucleotides.

Abstract: Compositions comprising an isolated peptide, which may for example optionally comprise a sequence selected from the group consisting of FDYDWY (SEQ ID NO: 2), SFSQNKSVHSFDYDWYNVSDQADLKN (SEQ ID NO: 3) or CSFSQNKSVHSFDYDWYNVSDQADLKNC (SEQ ID NO: 1), or any cyclized version thereof, and methods of using same, including for treatment of or prevention of formation of microbial biofilms and against adhesion of a cell to a surface.

Abstract: A novel group of gastrokines called Gastric Antrum Mucosal Protein is characterized. A member of the group is designated AMP-18. AMP-18 genomic DNA, cDNA and the AMP-18 protein are sequenced for human, mouse and pig. The AMP-18 protein and active peptides derived from it are cellular growth factors. Surprisingly, peptides capable of inhibiting the effects of the complete protein, are also derived from the AMP-18 protein. Cytoprotection and control of mammalian gastro-intestinal tissue growth and repair (restitution) is facilitated by the use of the proteins, making the proteins candidates for therapies in inflammatory bowel disease, mucositis, and gastric ulcers.

Abstract: The invention relates to the use, as an agent for treating human perspiration, in a cosmetic composition, of amino acid derivatives of formula (I) below: The invention also relates to a cosmetic process for treating perspiration and possibly the body odour associated with human perspiration, especially underarm odour. The invention also relates to novel amino acid derivatives of formula (II) that will be defined in detail hereinbelow, and to cosmetic or dermatological compositions containing them.

Abstract: A composition or vaccine composition comprising at least one peptide that has less than 600 contiguous amino acids having 100% identity to a native sequence of CEA, HER2/neu, MAGE2, MAGE3, or p53, the peptide further comprising at least one epitope selected from Table 6.

Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.

Abstract: The present invention relates to antibacterial peptides and analogs thereof, e.g., originating from, derived from, isolated and/or purified from mammalian milk, that reduce, inhibit and/or prevent the growth or proliferation of a bacterial organism.

Abstract: A nanothermometer is disclosed. In various embodiments, a nanothermometer comprises a nanoparticle such as a gold nanoparticle, a fluorophore, and a linker, such as a peptide linker, extending between the nanoparticle and the fluorophore, whereby the fluorophore is self-quenched. The linker can comprise one or more cysteines. An unheated thermometer shows little or no fluorescence. Upon heating, fluorophore-linker conjugates are released from the nanoparticle, thereby unquenching the fluorescence. An increase in fluorescence results. In some embodiments, the increase in fluorescence can be irreversible. Methods of measuring temperature of a sample such as a biological sample, and methods of synthesizing a nanothermometer, are also disclosed. A molecular thermometer is also disclosed.

Abstract: The present invention provides isolated peptides having the amino acid sequence of SEQ ID NO: 43 or immunologically active fragments thereof, which bind to HLA antigen and have cytotoxic T lymphocyte (CTL) inducibility. The present invention further provides peptides which include one, two, or several amino acid insertions, substitution or addition to the aforementioned peptides or fragments, but still have the cytotoxic T cell inducibility. Further provided are nucleic acids encoding any of these aforementioned peptides as well as pharmaceutical agents and compositions including any of the aforementioned peptides or nucleic acids. The peptides, nucleic acids, pharmaceutical agents and compositions of this invention may be used for treating cancer or tumor.

Abstract: The objective of the present invention is to develop and provide: a composition that more inexpensively and safely augments plant disease resistance and/or plant branching by inducing new plant disease resistance via a brassinosteroids; and a method for suppressing microbial infection of plants and a method for augmenting branching using the composition. Provided is a composition containing as the active ingredient a peptide hormone obtained on the basis of isolating a disease resistant brassinosteroid variant and analyzing the causative gene thereof.

Abstract: According to the present invention, peptides having the amino acid sequence of SEQ ID NOs: 14, 21, 23, 27, 36, 46, 57, 60 and 62 were demonstrated to have cytotoxic T lymphocyte (CTL) inducibility. Therefore, the present invention provides a peptide having the amino acid sequence selected from among SEQ ID NOs: 14, 21, 23, 27, 36, 46, 57, 60 and 62. The peptide can include one, two, or several amino acid substitutions, deletions, insertions, or additions so long as its CTL inducibility is retained. Furthermore, the present invention provides pharmaceutical agents for the treatment and/or prophylaxis of cancers, and/or prevention of postoperative recurrence thereof, which contain any of these peptides. Pharmaceutical agents of this invention include vaccines.

Abstract: The present invention relates to methods and kits for determining heparanase procoagulant activity in a biological sample. The invention also relates to diagnostic methods for the detection and/or monitoring of a coagulation-related pathologic disorder in a mammalian subject. The invention further relates to compositions comprising heparanase and at least one tissue factor, uses and methods based thereon in the treatment, amelioration and prevention of coagulation-related pathologic conditions. The invention still further relates to methods for screening a coagulation modulatory compound, methods and uses based thereon in the treatment, amelioration and prevention of coagulation-related pathologic conditions.

Abstract: The present invention includes a method of modulating the phagocytic activity of at least one phagocyte in a subject. The present invention also includes a method of providing a composition resistant to phagocytosis to a subject. The present invention further includes a method of treating, ameliorating or preventing an inflammatory disease in a subject.

Abstract: Disclosed are immunogenic peptides, related fusion proteins, nucleic acids encoding the peptides or fusion proteins, conjugates, expression vectors, host cells, and antibodies. Also, disclosed are pharmaceutical compositions, vaccines for use in the treatment or prevention of cancer, e.g., alveolar rhabodomyosarcoma, methods of stimulating a T cell to kill a tumor cell, methods of stimulating CD4+ and CD8+ T cells, and methods of treating or preventing cancer are further provided herein.

Abstract: The present invention relates to a system for intracellular delivery of a cargo comprising at least one component A chosen from aliphatic linear or branched moieties with at least 4 carbon atoms and/or cyclic ring systems comprising 2-4 rings which may contain several hetero atoms chosen from N, S, O and P, wherein component(s) A is (are) attached to a cell penetrating peptide B and/or a non-peptide analogue thereof. It also relates to methods of using the system in diagnosis of diseases, as research tool and as a targeting system, a composition comprising the system and especially a pharmaceutical composition a material covered with the system and a material having the delivery systems into the material. Finally it relates to novel peptides.

Abstract: The present invention provides peptides having an amino acid sequence as set forth in SEQ ID NO: 19, 22, 30, 34, 344, 358, 41, 44, 46, 48, 78, 376, 379, 80, 100, 101, 110, 111, 387, 112, 394, 114, 116, 117, 121, 395, 133, 135, 137, 426, 143, 147, 148, 149, 150, 152, 153, 154, 156, 160, 161, 162, 163, 166, 174, 178, 186, 194, 196, 202, 210, 213, 214, 217, 223, 227, 228, 233, 254, 271, 272 or 288, as well as peptides having the above-mentioned amino acid sequences in which 1, 2, or several (e.g., up to 5) amino acids are substituted, deleted, or added, provided the peptides possess cytotoxic T cell inducibility. The present invention also provides drugs for treating or preventing a disease associated with over-expression of the CDH3, EPHA4, ECT2, HIG2, INHBB, KIF20A, KNTC2, TTK and/or URLC10, e.g. cancers containing as an active ingredient one or more of these peptides. The peptides of the present invention find further utility as vaccines.

Abstract: The present invention provides artificial fusion proteins (AFPs) designed to elicit an anti-HIV immune response, as well as nucleic acid molecules and expression vectors encoding those proteins. The AFPs of the invention may comprise domains from various HIV proteins, such as Gag, Pol, Vif, and Env proteins, which are partial sequences. HIVCON is an AFP in which the HIV domains are from several HIV Glade consensus sequences and which optionally contains additional domains which may be useful, for example, in monitoring expression levels or laboratory animal immune responses. Other aspects of the invention may include compositions and methods for inducing an anti-HIV immune response in a subject, preferably with a DNA prime-MVA boost strategy, and to induce a cell-mediated immune response.

Abstract: The invention provides a peptide or peptidomimetic that is derived from or based upon the amino acid sequence of the C-terminal ?-helix or hypervariable region (HVR) or a Ras protein, a nucleic acid encoding the peptide or peptidomimetic, and methods employing the same.

Abstract: The present invention relates to peptides, nucleic acids and methods for transforming a bacterium belonging to the Streptococcus genus by natural competence and their use in the food and feed industry.

Abstract: Peptide antagonists of zonulin are disclosed, as well as methods for the use of the same. The peptide antagonists bind to the zonula occludens receptor, yet do not physiologically modulate the opening of mammalian tight junctions.

Abstract: It is disclosed herein that SPANX-B is uniquely expressed in a number of human tumors and that SPANX-B is an immunogenic antigen that is recognized by human T cells inducing helper CD4+ and cytolytic CD8+ T cell responses. Specific SPANX-B polypeptides and polynucleotides are disclosed that can be used to generate an immune response. In several embodiments, these polypeptides can be used for the treatment of a variety of cancers, including melanoma, colon carcinoma, ovarian cancer, breast cancer, myeloma, lung carcinoma and renal cancer.

Abstract: The present invention relates to ?-PNA monomers according to Formula I where substituent groups R1, R2, R3, R4, R5, R6, B and P are defined as set forth in the specification. The invention also provides methodology for synthesizing compounds according to Formula I and methodology for synthesizing PNA oligomers that incorporate one or more Formula I monomers.