Patents Represented by Attorney, Agent or Law Firm Elizabeth A. Hanley, Esq.
-
Patent number: 6833365Abstract: Methods and compositions for treating Cryptosporidium parvum related disorders in a mammal are discussed. Several novel tetracycline compounds useful for treating Cryptosporidium parvum related disorders are also included.Type: GrantFiled: January 23, 2001Date of Patent: December 21, 2004Assignee: Trustees of Tufts CollegeInventors: Stuart B. Levy, Mark L. Nelson
-
Patent number: 6830898Abstract: The present invention features methods for the identification of compounds and compositions useful as antibiotics and antibacterial agents. In particular, the invention features methods for the identification of modulators of a previously unidentified target protein, termed CoaX. High-throughput assay systems are featured as well as assay kits for the identification of CoaX modulators. Also featured are coaX nucleic acid molecules and purified CoaX proteins, as well as recombinant vectors and microorganisms including the gene, coaX.Type: GrantFiled: March 20, 2001Date of Patent: December 14, 2004Assignee: OmniGene Bioproducts, Inc.Inventors: R. Rogers Yocum, Thomas A. Patterson
-
Patent number: 6818634Abstract: Substituted tetracycline compounds, methods of synthesis, and methods of use are discussed. Tetracyclines useful for treating tetracycline related disorders are also discussed. Intermediates useful for synthesizing other tetracycline compounds are also included.Type: GrantFiled: March 30, 2001Date of Patent: November 16, 2004Assignees: Paratek Pharmaceuticals, Inc., Trustees of Tufts CollegeInventors: Mark L. Nelson, Stuart B. Levy, Roger Frechette, Todd E. Bowser, Mohamed Y. Ismail
-
Patent number: 6818635Abstract: The present invention pertains, at least in part, to novel 7-substituted tetracycline compounds. These tetracycline compounds can be used to treat numerous tetracycline compound-responsive states, such as bacterial infections and neoplasms, as well as other known applications for minocycline and tetracycline compounds in general, such as blocking tetracycline efflux and modulation of gene expression.Type: GrantFiled: June 29, 2001Date of Patent: November 16, 2004Assignees: Paratek Pharmaceuticals, Inc., Trustees of Tufts CollegeInventors: Mark L. Nelson, Roger Frechette, Peter Viski, Beena Bhatia, David Messersmith
-
Patent number: 6777224Abstract: The present invention provides a method for enzymatically producing optically active mandelic acid derivatives. An optically active mandelic acid derivative (shown as Formula II) is produced by reacting a culture or cell body of a microorganism, or processed products thereof, with a phenylglyoxylic acid derivative, and then recovering the obtained optically active mandelic acid derivative, wherein the microorganism has the ability to stereo-selectively reduce the phenylglyoxylic acid derivative. An optically active mandelic acid obtained according to the present invention is useful as an intermediate for the synthesis of pharmaceuticals and agricultural chemicals.Type: GrantFiled: October 23, 2002Date of Patent: August 17, 2004Assignee: Daicel Chemical Industries, Ltd.Inventors: Kazuya Mitsuhashi, Hiroaki Yamamoto
-
Patent number: 6756365Abstract: The present invention provides an improved methodology by which therapeutically to overcome resistance to tetracycline in living cells including bacteria, parasites, fungi, and rickettsiae. The methodology employs a blocking agent such as C5 ester derivatives, or 6-deoxy 13-(substituted mercapto) derivatives of tetracycline, in combination with other tetracycline-type antibiotics as a synergistic combination of compositions to be administered simultaneously, sequentially or concurrently. In another embodiment, certain novel compositions are provided which may be administered alone against, for example, a sensitive or resistant strain of gram positive bacteria such as S. aureus and E. faecalis. The concomitantly administered compositions effectively overcome the tetracycline resistant mechanisms present such that the cell is effectively converted from a tetracycline-resistant state to a tetracycline-sensitive state.Type: GrantFiled: February 16, 2000Date of Patent: June 29, 2004Assignee: Trustees of Tufts CollegeInventor: Stuart B. Levy
-
Patent number: 6756404Abstract: Autoinducer compounds which enhance gene expression in a wide variety of microorganisms, therapeutic compositions and therapeutic methods wherein gene expression within microorganisms is regulated are disclosed.Type: GrantFiled: March 13, 2002Date of Patent: June 29, 2004Assignee: The Research & Development Institute, Inc.Inventor: Tom Livinghouse
-
Patent number: 6723321Abstract: Provided are compositions and methods useful for modulating the activity of autoinducer synthase catalysts. A method for identifing modulators of the autoinducer synthesis reaction is also provided. Such modulators are useful for controlling bacterial growth and can be used for therapeutic treatment of bacterial infections particularly in immunocompromised subjects. They are also useful in treating disease states associated with autoinducer synthesis and biofilm development.Type: GrantFiled: January 6, 1999Date of Patent: April 20, 2004Assignees: The Board of Trustees of the University of Illinois, The University of Iowa Research FoundationInventors: E. Peter Greenberg, John E. Cronan, Jr., Bryce V. Plapp, Matthew R. Parsek
-
Patent number: 6720188Abstract: Methods and kits for determine arginine compounds are discussed. The methods and kits of the invention can be used for the diagnosis of arginine compound associated disorders.Type: GrantFiled: July 5, 2001Date of Patent: April 13, 2004Assignees: FAL DiagnosticsInventors: Rima Kaddurah-Daouk, Thomas W. Bell, Alisher B. Khasanov
-
Patent number: 6706764Abstract: The present invention relates to the use of creatine compounds including creatine, creatine phosphate or analogs of creatine, such as cyclocreatine, for treating diseases of the nervous system. Creatine compounds can be used as therapeutically effective agents against a variety of diseases of the nervous system such as diabetic and toxic neuropathies, peripheral nervous system diseases, Alzheimer disease, Parkinson's disease, stroke, Huntington's disease, amyotropic lateral sclerosis, motor neuron disease, traumatic nerve injury, multiple sclerosis, dysmyelination and demyelination disorders, and mitochondrial diseases.Type: GrantFiled: May 7, 1997Date of Patent: March 16, 2004Assignees: Avicena Group, Inc., The General Hospital CorporationInventors: Rima Kaddurah-Daouk, Ghaleb Daouk, M. Flint Beal
-
Patent number: 6696561Abstract: Isolated nucleic acid molecules, designated MCT nucleic acid molecules, which encode novel MCT proteins from Corynebacterium glutamicum are described. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing MCT nucleic acid molecules, and host cells into which the expression vectors have been introduced. The invention still further provides isolated MCT proteins, mutated MCT proteins, fusion proteins, antigenic peptides and methods for the improvement of production of a desired compound from C. glutamicum based on genetic engineering of MCT genes in this organism.Type: GrantFiled: June 23, 2000Date of Patent: February 24, 2004Assignee: BASF AktiengesellschaftInventors: Markus Pompejus, Burkhard Kröger, Hartwig Schröder, Oskar Zelder, Gregor Haberhauer
-
Patent number: 6683068Abstract: The present invention pertains to novel 7,9-substituted tetracycline compounds. These tetracycline compounds can be used to treat numerous tetracycline compound-responsive states, such as bacterial infections and neoplasms, as well as other known applications for minocycline and tetracycline compounds in general, such as blocking tetracycline efflux and modulation of gene expression.Type: GrantFiled: June 29, 2001Date of Patent: January 27, 2004Assignee: Paratek Pharmaceuticals, Inc.Inventors: Mark L. Nelson, Roger Frechette, Peter Viski, Mohamed Ismail, Todd Bowser, Laura McIntyre, Beena Bhatia, Paul Hawkins, Laxma Reddy, Karen Stapleton, Tad Warchol, Paul Sheahan
-
Patent number: 6677133Abstract: The instant methods and compositions represent an advance in controlling drug resistance in microbes. AcrAB-like efflux pumps have been found to control resistance to drugs, even in highly resistant microbes. Accordingly, methods of treating infection, methods of screening for inhibitors of AcrAB-like efflux pumps, and methods of enhancing antimicrobial activity of drugs are provided. Pharmaceutical composition comprising an inhibitor of an AcrAB-like efflux pump and an antimicrobial agent are also provided.Type: GrantFiled: September 28, 2001Date of Patent: January 13, 2004Assignee: Trustees of Tufts CollegeInventors: Margaret Oethinger, Stuart B. Levy
-
Patent number: 6660734Abstract: The invention relates to novel oxazinones designed to bind to the penicillin receptor, methods of synthesizing the compounds, and the use of the compounds as antibacterial agents. The compounds have the general formula (I) Preferably the compounds have a carboxyethyl or a substituted carboxymethyl substituent at the 2-position and a hydroxyl group at the 5-position and have a molecular shape suitable for binding to and reacting with the active site of a pencillin-recognizing enzyme. The compounds are synthesized by condensing a carboxyl-protected N-hydroxy amino acid with a 3-hydroxyprotected-4-bromobutanoic acid to form a a doubly protected N-hydroxy N-acylamino acid, which is cyclized with an organic base to yield a: doubly protected 1,2-oxazin-3-one. The protecting groups are then removed to provide an antibacterial agent.Type: GrantFiled: January 22, 2002Date of Patent: December 9, 2003Assignee: Simon Fraser UniversityInventors: Saul Wolfe, Christiana Akuche, Stephen Ro
-
Patent number: 6642270Abstract: 7-substituted fused ring tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7-substituted fused ring tetracycline compounds are described.Type: GrantFiled: May 10, 2001Date of Patent: November 4, 2003Assignee: Paratek Pharmaceuticals, Inc.Inventors: Mark L. Nelson, Laura McIntyre
-
Patent number: 6624168Abstract: 7, 8 and 9-substituted tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7, 8 and 9-substituted tetracycline compounds are described.Type: GrantFiled: June 29, 2001Date of Patent: September 23, 2003Assignee: Trustees of Tufts CollegeInventors: Mark L. Nelson, Darrell Koza
-
Patent number: 6617318Abstract: The present invention relates to 7-phenyl substituted tetracycline derivatives and compositions thereof.Type: GrantFiled: September 13, 2000Date of Patent: September 9, 2003Assignee: Trustees of Tufts CollegeInventors: Mark L. Nelson, Glen Rennie, Darrell J. Koza
-
Patent number: 6608025Abstract: A substantially pure polypeptide (human NESP55) comprising the amino acid sequence (SEQ ID NO: 2) IRLEVPKRMDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALL RALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEAD LELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPE DDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGE ELKPEDKDPRRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIP IRRH or a variant, fragment, fusion or derivative thereof, or a fusion of a said variant or fragment or derivative, wherein the polypeptide variant has an amino acid sequence which has at least 90% identity with the amino acid sequence given above. NESP55 or fragments thereof may be useful in medicine for the treatment of obesity.Type: GrantFiled: December 21, 1999Date of Patent: August 19, 2003Assignee: Knoll, AGInventors: Douglas Fraser, Steven St. Gallay
-
Patent number: 6599703Abstract: An iterative and regenerative method for sequencing DNA is described. This method sequences DNA in discrete intervals starting at one end of a double stranded DNA segment. This method overcomes problems inherent in other sequencing methods, including the need for gel resolution of DNA fragments and the generation of artifacts caused by single-stranded DNA secondary structures. A particular advantage of this invention is that it can create offset collections of DNA segments and sequence the segments in parallel to provide continuous sequence information over long intervals. This method is also suitable for automation and multiplex automation to sequence large sets of segments.Type: GrantFiled: February 16, 2001Date of Patent: July 29, 2003Assignee: University of Iowa Research FoundationInventor: Douglas H. Jones
-
Patent number: 6566086Abstract: Methods for the detection of creatine compound levels in body fluid samples are discussed. Portable kits capable of determining creatine levels using non-invasive and visually detectable methods are also included.Type: GrantFiled: January 28, 2000Date of Patent: May 20, 2003Assignee: FAL DiagnosticsInventors: Fahad Mohammed Saleh Al Athel, Thomas W. Bell, Alisher B. Khasanov, Rima Kaddurah-Daouk