Abstract: A method for operating a voicemail system can include receiving a call at the voicemail system, wherein the call originates from a calling party device, determining if the calling party device is compatible with a video greeting feature, sending a video greeting to the called party device if it is determined that the calling party device is compatible with the video greeting feature, and recording a voicemail message received in response to the video greeting being played on the called party device. Another method can include sending a video greeting identifier to the called party device, the video greeting identifier being used to identify a video greeting stored on the calling party device. Methods for operating a mobile device and a voicemail system are also disclosed.

Abstract: Disclosed herein are methods and systems for recognizing speech. A method embodiment comprises comparing received speech with a precompiled grammar based on a database and if the received speech matches data in the precompiled grammar then returning a result based on the matched data. If the received speech does not match data in the precompiled grammar, then dynamically compiling a new grammar based only on new data added to the database after the compiling of the precompiled grammar. The database may comprise a directory of names.

Abstract: Geo-targeting may be used in combination with wireless alert capabilities to provide alerts to a more granulated geographical area. Disclosed herein is a system and method for performing geo-targeting for various alert areas such that emergency messages may be delivered to mobile and static devices of different types in a localized area. In an example embodiment, geo-targeting supports the delivery area for wireless emergency alerts by identifying the cell sites that are in a specified geographic area that have technology capable of delivering wireless emergency alerts. The components of the telecommunications system that support a wireless emergency alert system may be identified and mapped to any geographical area. The method and system of geo-target mapping may provide an efficient and more robust way of determining the telecommunication components to be employed for broadcasting emergency alerts.

Abstract: A system and apparatus for managing media content is disclosed. An apparatus that incorporates teachings of the present disclosure may include, for example, a terminal device can have a controller element that receives a media guide from a Set-Top Box (STB), and presents on a display unit of the terminal device the media guide without presentation of said media guide on a media device coupled to the STB. Additional embodiments are disclosed.

Abstract: A computer readable medium is disclosed containing instructions that when executed by a computer perform a method for presenting advertising data, the method including but not limited to receiving a video data stream at an end user device, receiving a video data stream at an end user device; recognizing a pattern in the video data stream indicating a particular arrangement of objects in the video data stream as scene start data; placing scene start marker data in the video data stream at the scene start data; receiving end user trick play command data during presentation of the video data stream at the end user device; and moving to the scene start marker data in the video data in response to the end user trick play command data. A system is disclosed for executing the method. A data structure is disclosed for containing data used by the system and method.

Abstract: A method and system for automatically defining and provisioning organizational data in a unified messaging (UM) platform are disclosed. An adapter in a unified messaging platform connects to at least one client human resources database. Human resources information that is organized in an organizational hierarchy is retrieved from the human resources database, and hierarchical organizational data is automatically generated in the UM platform based on the organizational hierarchy of the human resources information retrieved from the human resources database. UM mailboxes are provisioned to messaging centers in the UM platform based on the hierarchical organizational data.

Abstract: A method and system for programming, using a removable storage, a remote control apparatus providing universal remote control functionality is disclosed. A removable storage module may be introduced into the remote control apparatus. Programming codes for a remote-controlled device controllable by the remote control apparatus may be transferred from the removable storage module. Executable code for configuring the remote control apparatus may also be transferred. The programming codes may be assigned to control elements of the remote control apparatus. The remote control apparatus may be configured to use at least one of the programming codes to remotely control the remote-controlled device.

Abstract: A system and method for determining an SMS retransmission schedule is provided. When a special error code is received by an SMSC, the SMSC can calculate the response time. The response time is the time that lapsed between forwarding the SMS message for delivery and receiving an error code. If the response time exceeds a response time threshold, the error code can be considered as falsely generated. A special retransmission schedule can be assigned to the SMS message. If the response time does not exceed a response time threshold, a different retransmission schedule can be assigned to the SMS message.

Abstract: Various embodiments of the present disclosure describe techniques for intelligent SMS/MMS routing. In some example embodiments of the present disclosure information indicative of the location of a mobile device can be used by a service provider to determine where to route an incoming SMS/MMS message. In the same, and other embodiments different information can be used to determine where to route incoming SMS/MMS messages such as the electronic address of the originator of the message, and/or whether the mobile device the message is addressed to is in communication with local devices.

Abstract: A method for accessing a remote network includes identifying a content server associated with the remote network, generating a uniform resource locator, embedding additional data in the uniform resource locator, encrypting the uniform resource locator, and accessing a server in the remote network identified by the uniform resource locator. The method further includes wherein the additional data comprises authentication data, a delivery session identification, a time stamp, or comprises subscriber identification data. The URL may provide access to the content server for a time period indicated by the time stamp. The method includes wherein at least the subscriber identification data prevents unauthorized sharing of the URL.

Abstract: Systems and methods of controlling communication of data are provided. A method of controlling communication of data may include receiving, at a network component, a request for data associated with a data source. The network component may have a limited capacity to distribute data. The method also includes determining whether the network component is exceeding a first capacity threshold. When the network component is exceeding the first capacity threshold, the method includes determining whether the data source meets a popularity criterion. When the data source meets the popularity criterion, the method includes sending the data associated with the data source.

Abstract: Voice service over a next generation network is provided using Advanced Intelligent Network solutions. According to an exemplary embodiment, a Voice over Network system includes a communications device having a directory communication address in communication with a telecommunications network, means for decoding the directory communications address to identify a voice over internet protocol service feature of the communications address, and means for establishing an internet protocol telephony communications connection of the communications device with a called party's communications address via a VoN hotline. According to further exemplary embodiments, the hotline may include a media gateway, an application server, a feature server, and means for communicating among the media gateway, the application server, and the feature server.

Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide has one or more sequences having at least 60% homology with any of SEQ ID 1-6, or has two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Abstract: This description provides tools and techniques for managing advertising services for mobile devices and users. These tools may provide methods that include establishing advertising databases for storing representations of geographic areas. These methods may include receiving bids from advertisers, with these bids referencing keywords and the geographic areas. The advertisers specified in the bids may be associated with the keywords and geographic areas specified in the bids, such that when a user of a mobile communications device activates the keyword within a geographic area, the mobile device received advertising information associated with the advertiser.

Abstract: A system and method are provided for content-based non-linear control of video data playback. A multimedia database having multimedia data including multimedia content data is searched based on a user query to determine a first set of multimedia data. The multimedia data includes indexes to and condensed representations of corresponding video data stored in a video database. A portion of the first set of multimedia data is displayed at a control device in response to the user query. A user of the control device selects an element of the first set of multimedia data for video playback and video data corresponding to the element delivered to a video device for playback. A user of the control device selects an element of the first set of multimedia data for additional information and a second set of multimedia data corresponding to the element delivered to the control device.

Abstract: A system for maintaining an address book, wherein the address book includes a plurality of entries with each entry containing contact information and wherein address book updates are transmitted over a wireless network. The system includes a gateway for storing the address book and transmitting the address book updates to a wireless device.

Abstract: The disclosure provides an adjustable modular skid system with a plurality of skid modules having a frame to support oil field fluid components, such as manifolds, mixing blocks, collection blocks, fracturing pumps, piping and connections, and other devices used to transport water, sand slurries, gas, oil, or other fluids in oil field applications. The modules can be arranged in multiple configuration to fit a particular well site. The modules can include supply modules, transition modules, and distribution modules. The skid modules can be coupled together through piping and relevant connections at the well site. If appropriate, the skid modules can be supported on pilings or other foundational supports. The system can be assembled remotely, started and tested, partially disassembled into the skid modules, and then installed at the well site with minimal additional effort by generally providing lines and connections between the modules.

Abstract: A system and method to use network flow records to generate information about changes in network routing and to understand the impact of these changes on network traffic. The inferences made can be determinative, if sufficient information is available. If sufficient information is not available to make determinative inferences, inferences may be made that narrow the range of possible changes that may have occurred to network traffic and the underlying network.