Patents Assigned to CEL-SCI Corporation
  • Publication number: 20210268101
    Abstract: The invention relates to novel peptide immunoconjugates for treatment, prevention, and diagnosis of coronaviral infections in animals and humans. The immunoconjugates can be used alone or in conjunction with vaccine adjuvants, immune system cells, or other immunomodulators.
    Type: Application
    Filed: January 13, 2021
    Publication date: September 2, 2021
    Applicant: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Patent number: 11041013
    Abstract: The invention is related to peptide constructs, i.e.
    Type: Grant
    Filed: March 16, 2009
    Date of Patent: June 22, 2021
    Assignee: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Patent number: 10179164
    Abstract: The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of cancer or the treatment of autoimmune diseases and compositions containing same, methods for producing same, and methods for using same; wherein the peptide constructs have the formula P1-x-P2 where P2 is a peptide associated with forms of cancer or an autoimmune condition and P1 is a peptide which will bind to a class of immune cells such as dendritic cells. The peptide construct can cause the maturation of immature dendritic cells to a more mature state. The peptide construct or the more mature dendritic cells can be administered to a subject to a modulate or to initiate an immune response against cancer cells, and can be used with dyes, radioisotopes, or therapeutic agents for detection of the immune target and/or treatment of cancer and autoimmune conditions.
    Type: Grant
    Filed: May 24, 2012
    Date of Patent: January 15, 2019
    Assignee: Cel-Sci Corporation
    Inventors: Daniel H. Zimmerman, Eyal Talor, Kenneth Rosenthal
  • Publication number: 20160158330
    Abstract: The invention is related to peptide constructs, i.e.
    Type: Application
    Filed: April 28, 2014
    Publication date: June 9, 2016
    Applicant: Cel-Sci Corporation
    Inventors: Daniel H. Zimmerman, Roy Carambula, Harold Steiner, Eyal Talor, Tibor Glant, Katalin Mikecz
  • Publication number: 20130266599
    Abstract: A vaccine for immunization against Type A influenza virus is provided having an immunologically effective amount of peptide constructs obtained by linking together two or more peptides based on or derived from different molecules, and methods for producing the same. The peptide constructs have the formula P1-x-P2 or P2-x-P1 where P1 is associated with Type A influenza highly conserved protein such as but not limited to M2e matrix protein, NP1 nucleoprotein, HA2 core 1, and HA2 core 2, where P2 is a peptide construct causing a Th1 directed immune response by a set or subset of T cells to which the peptide P1 is attached or that binds to a dendritic cell or T cell receptor causing said set or subset of dendritic cell or T cells to which the peptide P1 is attached to initiate and complete, an immune response, and x is a direct bond or divalent linker for covalently bonding P1 and P2.
    Type: Application
    Filed: December 13, 2011
    Publication date: October 10, 2013
    Applicant: Cel - Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Publication number: 20080063625
    Abstract: Methods for treating or preventing a disease or disorder, for example, cardiovascular disease, dyslipidemia; dyslipoproteinemia; hyperlipidemia; a disorder of glucose metabolism; Syndrome X; a peroxisome proliferator activated receptor-associated disorder; obesity; hypertension; and renal disease with a serum-free and mitogen-free mixture comprised of specific ratios of cytokines IL-1?, TNF-?, IFN-? and GM-CSF to Interleukin 2 (IL-2) such as Leukocyte Interleukin Injection (LI) or Multikine®.
    Type: Application
    Filed: July 29, 2005
    Publication date: March 13, 2008
    Applicant: CEL-SCI Corporation
    Inventors: Geert Kersten, Eyal Talor
  • Patent number: 7256254
    Abstract: Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
    Type: Grant
    Filed: December 12, 2005
    Date of Patent: August 14, 2007
    Assignee: CEL-SCI Corporation
    Inventor: Daniel Zimmerman
  • Patent number: 7199216
    Abstract: Conjugated peptides include a first peptide component which is an antigen associated with autoimmune disease, allergy, asthma or transplantation rejection and binds to an antigen-specific receptor on a T cell, and a second peptide component which corresponds to an “antigen presenting molecule”, namely, a peptide binding to a T cell surface receptor, which would normally promote T cell activation when the first peptide is bound to its antigen-specific T cell receptor. However, in this invention, the second peptide component has an amino acid sequence which is a modification of an antigen presenting T cell binding peptide, such modification blocking or inhibiting the engagement of receptor sites on the T cell surface (other than the antigen-specific T cell receptor). As a result, T cell activation is prevented, and is directed through antigen-specific T cell receptor occupation, without T cell activation, leading to antigen-specific T cell anergy and cell death.
    Type: Grant
    Filed: October 27, 2000
    Date of Patent: April 3, 2007
    Assignee: Cel-Sci Corporation
    Inventor: Eyal I. Talor
  • Publication number: 20060257420
    Abstract: The invention is related to peptide constructs, i.e.
    Type: Application
    Filed: May 31, 2006
    Publication date: November 16, 2006
    Applicant: CEL-SCI Corporation
    Inventor: Daniel Zimmerman
  • Patent number: 6995237
    Abstract: Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
    Type: Grant
    Filed: October 27, 2000
    Date of Patent: February 7, 2006
    Assignee: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Patent number: 6951647
    Abstract: The present invention is based, in part, on the discovery that a modified version of Peptide G (Asn Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO:2) obtained by replacing Asn with Asp to form Peptide G? (Asp Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO: 1) overcomes the long range stabilization problem of the peptide conjugates and, quite surprisingly, also enhances the immune response, particularly the CD4 related (cell mediated) response, of conjugated peptides (L.E.A.P.S. constructs) as previously described.
    Type: Grant
    Filed: May 24, 2001
    Date of Patent: October 4, 2005
    Assignee: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Patent number: 6896879
    Abstract: This invention relates to a breakthrough method for pre-sensitizing cancer prior to a therapeutic treatment such as chemotherapy, radiation therapy or immuno-therapy and a novel cytokine mixture used in the method thereof. The cytokine mixture is a serum-free and mitogen-free mixture comprised of specific ratios of cytokines such as IL-1?, TNF-?, IFN-? and GM-CSF to Interleukin 2 (IL-2), which is effective in inducing cancerous cells to enter a proliferative cell cycle phase thereby increasing their vulnerability to chemotherapy, radiation therapy and immuno-therapy. One such novel cytokine mixture is Multikine®, which can be used alone or in combination with other drugs for the treatment of cancer thereby increasing the success of cancer treatment and the disease free survival of cancer patients.
    Type: Grant
    Filed: July 3, 2003
    Date of Patent: May 24, 2005
    Assignee: CEL-SCI Corporation
    Inventor: Eyal Talor
  • Patent number: 6572860
    Abstract: Peptide constructs chemically synthesized to contain a Herpes Simplex Virus specific antigenic peptide, such as, the 322-332 peptide (H1) from the ICP27 protein of Herpes Simplex Virus (HSV-1) and a peptide from a T cell binding ligand (TCBL), such as &bgr;-2M (aa 35-50), which elicits a TH1-like response in vitro tests in mice, were protective against challenge with HSV.
    Type: Grant
    Filed: March 30, 2000
    Date of Patent: June 3, 2003
    Assignee: CEL-SCI Corporation
    Inventors: Daniel H. Zimmerman, Kenneth S. Rosenthal
  • Patent number: 6287565
    Abstract: A heteroconjugate is formed by linking a T cell binding ligand (TCBL) such as Peptide J of &bgr;-2 microglobulin to a modified HGP-30 antigentic peptide fragment of p17 gag peptide, such as, for example A T L  Y S V  H Q R  I D V  K D T (SEQ ID NO: 5) K E A  L E K  I E E  E Q N  K S The heteroconjugate is effective in eliciting a THI directed immune response and provides a vaccine composition for treating or preventing AIDS.
    Type: Grant
    Filed: June 15, 2000
    Date of Patent: September 11, 2001
    Assignee: Cel-Sci Corporation
    Inventors: Daniel H. Zimmerman, Prem S. Sarin
  • Patent number: 6268472
    Abstract: An antigenic peptide fragment from the p17 gag protein of HIV includes a portion from HGP-30 and a contiguous portion from HGP-35 such that the peptide fragment is capable of inducing a TH1 immune response when administered to a person suffering from AIDS or at risk for AIDS. The peptide has from about 25 to about 37 amino acids, such as, for example, the sequence A T L  Y S V 1 H Q R  I D V  K D T SEQ ID NO.
    Type: Grant
    Filed: June 9, 2000
    Date of Patent: July 31, 2001
    Assignee: CEL Sci Corporation
    Inventors: Daniel H. Zimmerman, Prem S. Sarin
  • Patent number: 6103239
    Abstract: A heteroconjugate is formed by linking a T cell binding ligand (TCBL) such as Peptide J of .beta.-2 microglobulin to a modified HGP-30 antigentic peptide fragment of p17 gag peptide, such as. for exampleATL YSV HQR IDV KDTKEA LEK IEE EQN KS (SEQ ID NO: 5)The heteroconjugate is effective in eliciting a THI directed immune response and provides a vaccine composition for treating or preventing AIDS.
    Type: Grant
    Filed: August 9, 1996
    Date of Patent: August 15, 2000
    Assignee: CEL-SCI Corporation
    Inventors: Daniel H. Zimmerman, Prem S. Sarin
  • Patent number: 6096315
    Abstract: The present invention relates to a heterofunctional cellular immunological reagent comprising at least two T cell specific binding ligands covalently linked together, wherein one of the T cell specific binding ligands binds to a specific class or subclass of T cells and another of the T cell specific binding ligands is an antigen associated with disease or a causative agent of disease, or epitope thereof. The present invention also relates to vaccines containing the heterofunctional cellular immunological reagents and methods for the use of the same.
    Type: Grant
    Filed: June 6, 1995
    Date of Patent: August 1, 2000
    Assignee: Cel Sci Corporation
    Inventors: Daniel H. Zimmerman, Donald A. Elliott
  • Patent number: 6093400
    Abstract: An antigenic peptide fragment from the p17 gag protein of HIV includes a portion from HGP-30 and a contiguous portion from HGP-35 such that the peptide fragment is capable of inducing a TH1 immune response when administered to a person suffering from AIDS or at risk for AIDS.
    Type: Grant
    Filed: August 9, 1996
    Date of Patent: July 25, 2000
    Assignee: Cel Sci Corporation
    Inventors: Daniel H. Zimmerman, Prem S. Sarin
  • Patent number: 5652342
    Abstract: The present invention relates to a heterofunctional cellular immunological reagent comprising at least two T cell specific binding ligands covalently linked together, wherein one of the T cell specific binding ligands binds to a specific class or subclass of T cells and another of the T cell specific binding ligands is an antigen associated with disease or a causative agent of disease, or epitope thereof. The present invention also relates to vaccines containing the heterofunctional cellular immunological reagents and methods for the use of the same.
    Type: Grant
    Filed: December 8, 1994
    Date of Patent: July 29, 1997
    Assignee: Cel-Sci Corporation
    Inventors: Daniel H. Zimmerman, Donald A. Elliott