Abstract: A system (1) for analyzing solid particles in a medium (2), includes illumination elements (3) capable of generating a light field (30) in the medium (2), elements (4) for trapping at least a portion (30?) of the light field (30) generated and arranged in the direction (31) of the light field, and main detection element (5) for detecting the light field (30?) diffused by the solid particles within the medium (2). The main detection element includes a photodetector (52) for the light field (30?) diffused by the solid particles in the medium and a counter (53) for counting these solid particles in this medium, this main detection element being positioned in a direction (51) forming an angle (?) substantially ranging between 10° and 20° with respect to the direction of the light field generated. A method for analyzing solid particles in a medium implementing such an analysis system is described.

Abstract: Protein family derived from the protein defined by the amino acid sequence of QGPGRQPDFQRCGQQLRNISPPQRCPSLRQAVQLTHQQQGQVGPQQVRQMYRVAS NIPST (SEQ ID NO:6) is described.