Patents Assigned to Garvan Institute of Medical Research
  • Patent number: 6528303
    Abstract: The invention provides isolated DNA molecules encoding the human, mouse and rat NPY-Y5 receptors. These isolated DNA molecules can be used to express the NPY-Y5 receptors in cells which can then be used to screen compounds for NPY agonist and antagonist activity.
    Type: Grant
    Filed: April 22, 1998
    Date of Patent: March 4, 2003
    Assignee: Garvan Institute of Medical Research
    Inventor: Herbert Herzog
  • Patent number: 6472516
    Abstract: Isolated DNA molecules are disclosed corresponding to a novel progestin-regulated gene (PRG1). The PRG1 polypeptide (PRG1) and uses thereof are also described, and include assays for assessing progestin-responsiveness in a subject.
    Type: Grant
    Filed: April 24, 1998
    Date of Patent: October 29, 2002
    Assignee: The Garvan Institute of Medical Research
    Inventors: Colin Kenneth William Watts, Jenny Ann Hamilton
  • Patent number: 6465623
    Abstract: The present invention provides the nucleotide and amino acid sequence of a previously unidentified erbB receptor target.
    Type: Grant
    Filed: April 22, 1998
    Date of Patent: October 15, 2002
    Assignee: Garvan Institute of Medical Research
    Inventors: Roger John Daly, Robert Lindsay Sutherland
  • Patent number: 6274352
    Abstract: A method of assessing an individual's predisposition to bipolar affective disorder comprises determining the presence of one or more bipolar affective disorder-linked markers on chromosome 4 or analyzing allelic variation in relation to a bipolar affective disorder susceptibility gene on chromosome 4.
    Type: Grant
    Filed: February 19, 1999
    Date of Patent: August 14, 2001
    Assignee: Garvan Institute of Medical Research
    Inventors: Peter Robert Schofield, Philip Bowden Mitchell, Linda Jacqueline Adams
  • Patent number: 5948951
    Abstract: An expression vector for use in producing transgenic animals and cell lines, the expression vector comprising a portion of the 5' flanking sequence of the human osteocalcin gene and a portion of the 3' flanking sequence of the human osteocalcin gene, the flanking sequences being separated by a linker encoding at least one unique restriction site. Reporter genes introduced into the linker can be expressed in a bone cell-specific manner in animals for screening therapeutic compounds suspected to affect osteoblasts and/or bone physiology.
    Type: Grant
    Filed: June 17, 1997
    Date of Patent: September 7, 1999
    Assignee: Garvan Institute of Medical Research
    Inventors: Edith Margaret Gardiner, John Allan Eisman, Christopher Patrick White, Nigel Alexander Morrison
  • Patent number: 5756460
    Abstract: The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.
    Type: Grant
    Filed: July 25, 1995
    Date of Patent: May 26, 1998
    Assignee: Garvan Institute of Medical Research
    Inventors: Helen Frances Evans, John Shine
  • Patent number: 5756667
    Abstract: The present invention consists in a method of preparing amino thiohydantoins either in isolation or as the C-terminals residue of a peptide. The method comprises reacting the amino acid or peptide with an acylating agent and thiocyanate or isothiocyanates in the presence of a strong acid. The present invention also relates to an improved method for C-terminal sequencing of peptides which routinely analyses all of the common amino acids of peptides. The invention involves the use of a strong, volatile, anhydrous organic or mineral acid to cleave the terminal amino acid thiohydantoin.
    Type: Grant
    Filed: September 23, 1994
    Date of Patent: May 26, 1998
    Assignee: Garvan Institute of Medical Research
    Inventors: Adam Inglis, Albert Peng Sheng Tseng, Peter Laurence Adams
  • Patent number: 5656602
    Abstract: The present invention provides peptides and compounds which inhibit the enzyme activity of Type II phospholipases A.sub.2. The preferred compounds are pentapeptides. Where the phospholipase is human Type II phospholipase A.sub.2 the preferred peptides are FLSYK and KFLSY.
    Type: Grant
    Filed: March 3, 1994
    Date of Patent: August 12, 1997
    Assignee: Garvan Institute of Medical Research
    Inventors: Albert Peng Sheng Tseng, Adam Inglis, Kieran Scott
  • Patent number: 5595902
    Abstract: The present invention relates to protein kinase C (iota). The present invention provides this protein in a substantially pure form and also provides nucleotide sequences encoding the protein. The invention further relates to methods of screening for compounds having human protein kinase C (iota) agonist or antagonist activity.
    Type: Grant
    Filed: December 2, 1994
    Date of Patent: January 21, 1997
    Assignee: Garvan Institute of Medical Research
    Inventors: Trevor J. Biden, Lisa Selbie
  • Patent number: 5593833
    Abstract: The present invention provides a genetic test for assaying predisposition to and/or resistance to high rates of bone turnover, development of low bone mass and responsiveness or otherwise to therapeutic modalities. This is a specific model for use in prediction of osteoporosis and likely response to preventive or therapeutic modalities. It is a general model of allelic variation in transcriptional regulators determining physiological set-points and thus susceptibility or resistance to certain pathophysiological states.
    Type: Grant
    Filed: March 2, 1995
    Date of Patent: January 14, 1997
    Assignee: Garvan Institute of Medical Research
    Inventors: Nigel A. Morrison, John A. Eisman, Paul J. Kelly
  • Patent number: 5571695
    Abstract: The invention provides cDNA sequence and a genomic DNA sequence which encodes the human neuropeptide Y-Y1 receptor. These DNA sequences can be used to express the NPY-Y1 receptor in cells and can be sued to screen compounds for neuropeptide Y agonist and antagonist activity.
    Type: Grant
    Filed: May 26, 1994
    Date of Patent: November 5, 1996
    Assignee: Garvan Institute of Medical Research
    Inventors: Lisa Selbie, Herbert Herzog, John Shine