Abstract: A method for printing uses at least one bio-ink. The method also uses at least one laser print head to deposit at least one droplet of at least one bio-ink onto a depositing surface of a receiving substrate. The printing method uses at least one nozzle print head to deposit at least one droplet of at least one bio-ink onto a depositing surface of the same receiving substrate as the laser print head.

Abstract: The present invention relates to the Compound of following formula (I): or a pharmaceutically acceptable salt thereof. The present invention also relates to a pharmaceutical composition containing such a compound and a method for preparing such a compound.

Abstract: The present invention relates to the field of cardiology and, more specifically, to a novel algorithm that can be used, in particular, in a method for determining if a drug is likely to induce a cardiac ventricular repolarisation disturbance, based on variations in electrocardiogram data.

Abstract: Disclosed are agents inhibiting the interaction between CFH and CD11b/18, as well as the use of such agents, in particular for treating inflammatory disorders, such as age-related macular degeneration.

Abstract: The invention relates to constructs, vectors, relative host cells and pharmaceutical compositions which allow an effective gene therapy, in particular of genes larger than 5 Kb by using an improved hybrid dual recombinant AAV vector system.

Abstract: The present invention concerns a compound of formula (I), or one of its pharmaceutically acceptable salts, especially for use as inhibitors of the ERK kinase activity in particular ERK2 activity, it also concerns prodrugs of these compounds.

Abstract: The present Inventors demonstrated that the RelB subunit of NF?B plays a crucial role in promoting cell migration. More precisely, they identified that this pro-migratory activity is mediated by the activation of the NF?B pathway through RelB phosphorylation at serine 472. In a first aspect, the present invention proposes to monitor the activation of the NF?B pathway by following the phosphorylation status of said serine. Also, the present invention discloses methods and kits for prognosing the evolution of a disease involving cell migration in a subject—treated or not—suffering thereof, based on the detection of said RelB-S472 phosphorylation.

Abstract: The present invention relates to inhibitors of gangliosides metabolism for treating motor neuron diseases, in particular hereditary spastic paraplegias.

Abstract: The invention relates to a method for inducing human cholangiocyte differentiation of progenitor cells called hepatoblasts. More specifically, the invention relates to a method for differentiating hepatoblasts to cholangiocytes by culturing said hepatoblasts with a particular medium having interleukin-6 (IL-6) activity. The differentiation method can specifically induce cholangiocyte differentiation from hepatoblasts, and the human cholangiocytes differentiated according to the invention may be useful for drug discovery for treatment of cholangiopathies and bioengineered livers.

Abstract: The present invention relates to methods and pharmaceutical compositions for the treatment of systemic mastocytosis. The inventors showed the effect of KPT-251 treatment on SCF-dependent human Mast cell (MC) line without KIT mutation (WT ROSA) and on two factor-independent MC lines with KIT mutations : ROSA ? 417-419 insY and ROSA D816V. KPT is a Selective Inhibitor of Nuclear Export (SINE) that specifically inhibits the activity of the exportin-1 (XPO1). KPT-251 treatment induces minimal toxicity in non-cancerous hematopoietic cells both in vitro and in vivo. In particular, the present invention relates a method of treating systemic mastocytosis in patient in need thereof comprising administering to the patient a therapeutically effective amount of a XPO1 inhibitor.

Abstract: Disclosed is a method for assistance with the establishment of a diagnosis of a patient, starting from at least one identified sign, and based on a computerized knowledge database including a medical ontology. The medical ontology includes: a list of signs forming a “sign” class; a list of pathological states forming a “pathological state” class; and a first set of logical relationships between the signs and the pathological states, each logical relationship establishing a correlative link between a sign and a pathological state. The method includes: a step of searching for potential pathological states, linked to at least one of the identified signs by the first set of logical relationships; and a step of identifying potential signs in which, for each potential pathological state, all of the signs linked by a correlative link to the potential pathological state are identified by the first set of logical relationships.

Abstract: The disclosure is directed at providing molecular tools and methods for transgenes integration in the genome of host cells, in particular tools and method enabling a transposition-dependent expression of the transgene, thereby facilitating identification and selection of effectively transformed hosts.

Abstract: The present invention relates to methods for predicting acute severe colitis treatment response. Currently, there is no biomarker of drug response. The present invention provides the first prediction tool for responses to first- and second-line treatments in acute severe ulcerative colitis. Putative mRNA targets of dysregulated microRNAs were identified from patient biopsies. One classifier of fifteen colonic microRNAs plus five biological values at admission were identified with a prediction accuracy of 96.6% for discriminating responders from non-responders to steroids. Using a similar method, 6 and 4 mucosal microRNA-based algorithms were identified to classify responders from non-responders to infliximab and cyclosporine.

Abstract: Disclosed herein is a method for classifying a patient at risk for heart failure, wherein the method comprises the steps of (i) measuring the concentration of IGFBP2 in a sample obtained from the patient and (ii) comparing the concentration of IGFBP2 measured in step (i) to a control value derived from the concentration of IGFBP2 in samples from patients who are at particular stages of heart failure and/or to a control value derived from the concentration of IGFBP2 in blood samples from healthy patients.

Abstract: The invention is directed to the field of gene therapy, i.e. gene delivery into target cells, tissue, organ and organism, and more particularly to gene delivery via viral vectors. The inventors showed that it is possible by chemical coupling to modulate the coupling of a ligand in the surface of the capsid of AAV, for example AAV2 and AAV3b. In particular, the present invention relates to a recombinant Adeno-Associated Virus (rAAV) vector particle having at least one primary amino group contained in the capsid proteins, chemically coupled with at least one ligand L, wherein coupling of said ligand L is implemented through a bond comprising a —CSNH— bond and an optionally substituted aromatic moiety. Particularly, the inventors tested the chemical coupling of mannose ligand on AAV2 for subretinally injection to rats.

Abstract: An immunogenic product including a cytokine conjugated with a carrier protein, wherein the cytokine is selected from the group including IL-4, IL-13 and mixtures thereof, and wherein the carrier protein is CRM197. Further, a method for manufacturing the immunogenic product. Also, the therapeutic use of the immunogenic product for treating an inflammatory disorder associated with aberrant IL-4 and/or IL-13 expression or activity.

Abstract: Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.

Abstract: According to a first aspect, the present disclosure relates to a digital holography device (100) for full-field blood flow imaging of ocular vessels of a field of view of a layer (11) of the eye (10). The device comprises an optical source (101) configured for the generation of an illuminating beam (Eobj) and a reference beam (ELO), and a detector (135) configured to acquire a plurality of interferograms (I(x,y,t)) wherein an interferogram is defined as the signal resulting from the interference between the said reference beam (ELO) and a part of said illuminating beam (Eobj) that is backscattered from said layer (11).

Abstract: The present invention concerns metallated porphyrin derivatives as ligands of G-quadruplex and their novel use as anti-viral agents.

Abstract: A method of culturing animal cells, preferably primary hepatocytes, including a first step of culturing the animal cells in non-adherent culture vessel, preferably a low or ultra-low attachment culture vessel, a second step of embedding the animal cells in a collagen matrix or in a gelatin matrix, and a third step of culturing the animal cells embedded in the collagen matrix or in the gelatin matrix, thereby obtaining 3D animal cell structures including proliferative animal cells, preferably spheroids including proliferative primary hepatocytes. Also, a spheroid including proliferative primary hepatocytes and the uses thereof for engineering an artificial liver model or an artificial liver organ, and for assessing in vitro the liver toxicity, genotoxicity and/or the effects of a drug or a compound.