Abstract: Novel compounds, 9-substituted guanines, with the following general formula ##STR1## where R' is acetyl;R" is 2-tetrahydrofuryl or 2-tetrahydropyranyl.The proposed compounds have antiviral activity.

Abstract: The human leukocyte interferon is essentially a protein featuring the foling sequence of aminoacids:CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAF HEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNE DSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD.A method for producing said interferon N is bacterial cells incorporates isolation of matrix poly (A)-mRNA from induced human leukocytes, synthesis of the gene of said interferon, insertion in the vector plasmid pBR 322 under the control of a tryptophane promotor, and transformation of the resultant recombinant DNA of the E. coli bacterial cells.According to the invention, used as the interferon gene is the gene of interferon N featuring the following primary structure of DNA: ##STR1## The human leukocyte interferon features an antiviral potency and can find application in medical practice.

Abstract: Substituted 3-hydrazinopropionates comprising compounds of the general fola: ##STR1## wherein R.sup.1, R.sup.2 =H, an alkyl, a substituted alkyl, hydroxycarbonyl, alkoxycarbonyl, an aryl, an aralkyl, an unsaturated alkyl, a substituted aryl or a substituted aralkyl: ##STR2## wherein R.sup.7, R.sup.8 =H, an alkyl, an unsaturated alkyl, an aralkyl, an aryl, a substituted alkyl,R.sup.9 =OH, an alkoxy, an aralkoxy, an alkyl, an unsaturated alkyl, an aryl, a substituted aryl, an aralkyl;R.sup.4 is --C.tbd.N, --COR.sup.10, wherein R.sup.10 =OR.sup.11, NR.sup.12 R.sup.13, where R.sup.11 is H, an alkyl, an aralkyl and an alkali metal, R.sup.11 and R.sup.12 are each H, an alkyl, an aralkyl, an aryl;R.sup.5, R.sup.6 = an alkyl, an aryl, an aralkyl.

Abstract: Disclosed is an antibacterial pharmaceutical composition comprising potasm salt of N-[.beta.-(5'-nitrofuryl-2')-acrylidene]-1-aminohydantoin and basic magnesium carbonate in conjunction with a pharmaceutically suitable filler.The proposed antibacterial pharmaceutical composition has a broader spectrum of action and a higher biological accessibility than the other antibacterial pharmaceutical compositions of the nitrofuran series known in the prior art. The proposed pharmaceutical composition is considerably less toxic than the prior-art antibacterial pharmaceutical compositions of the nitrofuran series and affords a bacteriostatic effect exceeding appreciably that of the prior-art antibacterial pharmaceutical compositions of the nitrofuran series.

Abstract: 2-(2,6-dimethyl-3,5-diethoxycarbonyl-1,4-dihydropyridine-4-carboxamide) glutaric acid of formula I and its disodium salt of formula II ##STR1## Said acid is obtained from glutaminic acid and dimethyl 3,5-diethoxycarbonyl-1,4-dihydroisonicotic acid.For obtaining disodium salt, said acid is reacted with a caustic soda solution.These compounds possess antiarrhythmic activity.

Abstract: The novel compound according to the invention 3-(2,2,2-trimethylhydrazinium)-propionate has the general formula:(CH.sub.3).sub.3 NNHCH.sub.2 CH.sub.2 COO.2H.sub.2 O.The method for preparing this novel compound comprises passing a solution of 3-(2,2,2-grimethylhydrazinium) alkylpropionate of the formula:X.sup.- (CH.sub.3).sub.3 N.sup.+ NHCH.sub.2 CH.sub.2 COORwherein X is Cl, Br, I, CH.sub.3 SO.sub.4, R is a loawer alkyl, through a column with a strongly-basic anion exchange resin, followed by isolation of the desired product. The growth stimulator for animals and fowl contains the novel compound, i.e. 3-(2,2,2-trimethylhydrazinium)-propionate as the active principle.

Abstract: New compounds of the nitrofuran series are provided, having the following general base formula: ##STR1## where R=CH.sub.2 CH.sub.2 CH.sub.2 OH; --CH(CH.sub.3)(CH.sub.2).sub.3 N(C.sub.2 H.sub.5).sub.2n=1,2and which may be in the form of salts.These compounds, both in the form of base and salt, exhibit a contact-action antiblastic effect. The advantage of these compounds resides in high selectivity of their action on tumoral cells combined with a germicidal activity.These compounds may be used in the medicine as an active source of antiblastic preparations.