Abstract: The present invention relates generally to methods for identifying drug side effects by detecting perturbations in organ-specific molecular blood fingerprints. The invention further relates to methods for identifying drug-specific organ-specific molecular blood fingerprints. As such, the present invention provides compositions comprising organ-specific proteins, detection reagents for detecting such proteins, and panels and arrays for determining organ-specific molecular blood fingerprints.

Abstract: The invention provides a diverse population of uniquely labeled probes, containing about thirty or more target specific nucleic acid probes each attached to a unique label bound to a nucleic acid. Also provided is a method of producing a population of uniquely labeled nucleic acid probes. Also provided is a method of detecting a nucleic acid analyte. The method consists of (a) contacting a mixture of nucleic acid analytes under conditions sufficient for hybridization with a plurality of target specific nucleic acid probes each having a different specifier; (b) contacting the mixture under conditions sufficient for hybridization with a corresponding plurality of anti-genedigits each having a unique label, the plurality of anti-genedigits having a diversity sufficient to uniquely hybridize to genedigits within the specifiers, and (c) uniquely detecting a hybridized complex between one or more analytes in the mixture, a target specific probe, and an anti-genedigit.

Abstract: The invention is directed to an improved method to manufacture virus for use in vaccine by culturing infected cells that have been modified to overexpress miR-144. The invention is also directed to manipulating the activity or level of miR-144 in subjects in order to modulate the antiviral and immune response systems.

Abstract: Methods, compositions, and devices are disclosed which use microRNA to detect, predict, treat, and monitor physiological conditions such as disease or injury. microRNA are isolated and their differential expression is measured to provide diagnostic information. This information may then be utilized for evaluation and/or treatment purposes.

Abstract: A system and method for automatically observing and counting cells without using a stain or a fluorescent material. The system includes an optical microscope having a sensor that provides an electrical signal representative of a field of view. The microscope is motorized so as to allow automatic change of focus. A sample containing cells to be analyzed is provided. No stain or fluorescent substance is used. When the microscope is operated in a deliberately out-of-focus condition, cells appear to have either a bright or a dark spot that can be used to report the number of cells in the sample. The intensity variation detected in images acquired in different focal planes is used to identify cell shapes using image analysis software such as CellProfiler. A result is reported in any convenient format, such as a false color image.

Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.

Abstract: The present invention relates generally to methods for identifying and using organ-specific proteins and transcripts. The present invention further provides compositions comprising organ-specific proteins and transcripts encoding the same, detection reagents for detecting such proteins and transcripts, and diagnostic panels, kits and arrays for measuring organ-specific proteins/transcripts in blood, biological tissue or other biological fluid.

Abstract: Concentrations of certain miRNA, mRNA and/or protein markers in the biological fluids and/or tissues of a subject are used to determine the probability that the subject does or does not have Posttraumatic Stress Disorder (PTSD). The concentrations of these markers in fluids and/or tissues are different in subjects with PTSD as compared to subjects who do not suffer from this disorder.

Abstract: Concentrations of certain miRNA, mRNA and/or protein markers in the biological fluids and/or tissues of a subject are used to determine the probability that the subject does or does not have Posttraumatic Stress Disorder (PTSD). The concentrations of these markers in fluids and/or tissues are different in subjects with PTSD as compared to subjects who do not suffer from this disorder.

Abstract: Signatures indicative of cancer grades are based on over- and under-expression of 214 genes that characterize expression patterns in CD133+ cells.

Abstract: Fourteen markers not previously known to be associated with liver injury have been identified. Methods to diagnose a subject for liver injury using these markers are described.

Abstract: Determination of the level and identity of various RNA molecules in circulation or tissues of subjects permits determination of microbiome composition and function of the subject as well as providing an index to health of various organs. Because rapid parallel sequencing techniques are available, such determinations can be conducted on a practical level.

Abstract: The present invention relates generally to methods for identifying drug side effects by detecting perturbations in organ-specific molecular blood fingerprints. The invention further relates to methods for identifying drug-specific organ-specific molecular blood fingerprints. As such, the present invention provides compositions comprising organ-specific proteins, detection reagents for detecting such proteins, and panels and arrays for determining organ-specific molecular blood fingerprints.

Abstract: The present invention relates generally to methods for identifying and using organ-specific proteins and transcripts. The present invention further provides compositions comprising organ-specific proteins and transcripts encoding the same, detection reagents for detecting such proteins and transcripts, and diagnostic panels, kits and arrays for measuring organ-specific proteins/transcripts in blood, biological tissue or other biological fluid.

Abstract: The invention provides improved crosslinkers which permit more efficient determination of protein interactions in biological samples.

Abstract: The present invention relates to compositions and methods for detection and quantification of individual target molecules in biomolecular samples. In particular, the invention relates to coded, labeled probes that are capable of binding to and identifying target molecules based on the probes' label codes. Methods of making and using such probes are also provided. The probes can be used in diagnostic, prognostic, quality control and screening applications.

Abstract: Methods for determining the presence, absence and/or amount and/or identity of RNA in a biological or other sample employs capturing and separating a DNA:RNA hybrid formed by a DNA probe and the RNA of interest from unhybridized DNA and RNA with an RNase H under conditions wherein the nuclease activity of the RNase H is inhibited, releasing the DNA probe by altering the conditions so that the nuclease activity is restored, and determining the presence or amount, and, for multiplex samples, nature of the DNA released. The method can be used to determine RNA of various types, including RNA comprising transcriptomes.

Abstract: New markers for diseased liver conditions have been identified. A combination of protein C (PROC) and retinol binding protein 4 (RBP4) in blood are biomarkers to distinguish patients at different stages of hepatic fibrosis due, for example, to chronic infection with hepatitis C virus (HCV). Also, alpha-1-B glycoprotein (A1BG), complement factor H (CFH) and insulin-like growth factor binding protein acid labile subunit (IGFALS) distinguish subjects with chronic or acute liver conditions such as hepatitis infection or liver fibrosis from healthy controls.

Abstract: Methods of using halogenated peptides as internal standards for liquid chromatography-mass spectrometry, and novel halogenated peptides useful for the same, are disclosed. In particular, methods of using halogenated peptides as internal standards in proteomic analyses, as well as methods of using halogenated peptides to conduct quality control assessments of and/or to calibrate liquid chromatography-mass spectrometry systems are disclosed.

Abstract: The invention provides a method of detecting a nucleic acid analyte. The method consists of (a) contacting a mixture of nucleic acid analytes under conditions sufficient for hybridization with a plurality of target specific nucleic acid probes each having a different specifier; (b) contacting the mixture under conditions sufficient for hybridization with a corresponding plurality of antigenedigits each having a unique label, the plurality of anti-genedigits having a diversity sufficient to uniquely hybridize to genedigits within the specifiers, and (c) uniquely detecting a hybridized complex between one or more analytes in the mixture, a target specific probe, and an anti-genedigit.