Abstract: Provided are a method of forming an upper electrode of a nanowire array and a nanowire array having an upper electrode formed thereon. The method includes a step of placing a polymeric thin film layer, a step of pressing, a step of treating a mixed solution, a step of etching, and a step of depositing an electrode material, such that the upper electrode is reliably formed in a state in which the polymeric thin film layer is formed on a portion of the nanowire, thereby making it possible to implement various nano-devices based on the nanowire array aligned on a substrate having a large area.

Abstract: Methods and devices for biological sample preparation and analysis are disclosed. A device may have a linear or circular arrangement of containers, with a connecting structure such as a bar or disk. Fluidics channels between containers allow the performance of different techniques for sample preparation, such as lysing, washing and elution. Different functional elements, such as grinders or mixers, may be attached to the containers. The device may have a reaction cartridge with a reaction chamber to perform techniques such as polymerase chain reaction.

Abstract: A focusing solar light guide module includes a lens array plate and a light guide plate. The lens array plate includes at least one lens. Each lens receiving and focusing a sunlight has an upper curved surface and a lower plane surface. The light guide plate has an upper plane surface parallel to the lower plane surface of the lens array plate and a lower microstructure surface. The lower microstructure surface includes at least one depressed area and at least one connection area parallel to the upper plane surface of the light guide plate. The connection area is connected between the adjacent depressed areas having a depressed point, a first inclined plane and a second inclined plane. The first inclined plane and the second inclined plane are respectively connected between the depressed point and the adjacent connection area.

Abstract: A method of transmitting a beamforming report frame for transmit beamforming is provided. The method may include acquiring, by a receiver, data of a signal transmitted by a transmitter, selecting either media access control (MAC) software or MAC hardware, to assign a sequence number based on a type of the data, and assigning a sequence number to the management frame based on the data, using either the MAC software or MAC hardware that is selected.

Abstract: The present invention provides a compound of the formula (I): wherein: R2 and R3 represent each independently a hydrogen atom or a hydrocarbon group; A represents an s-valent organic group; and s is an integer of 2-10. This nitrileoxide compound has stable and can be easily produced.

Abstract: The present invention is about the design and manufacturing method of constructing nano-structured lattices. The design of the four periodic two-dimensional lattices (hexagonal, triangulated, square and Kagome) is described; and the process of making nano-structured lattices is outlined in the present invention.

Abstract: Novel gripping structures based on van der Waals adhesive forces are disclosed. Pads covered with fibers can be activated in pairs by opposite forces, thereby enabling control of the adhesive force in an ON or OFF state. Pads can be used in groups, each comprising a group of opposite pads. The adhesive structures enable anchoring forces that can resist adverse forces from different directions. The adhesive structures can be used to enable the operation of robots on surfaces of space vehicles.

Abstract: A method for controlling access of a processor to a resource, wherein the processor has an instruction set including a virtualization extension, may include executing a resource access instruction by the processor using the virtualization extension, whereby the resource access instruction conveys a virtual address (VA) and a virtual machine identifier. The method may also include translating the virtual address to a physical address based on the virtual machine identifier, and looking-up an access control rule table using the physical address as a search key. Each entry of the rule table includes a virtual machine identifier. The method further includes controlling access to the resource based on the output of the rule table and a match between the virtual machine identifier returned by the table and the virtual machine identifier conveyed in the resource access instruction.

Abstract: Disclosed is a convergence machining apparatus based on turning in which a rotational axis of a work piece fixed by a headstock and a tailstock and a center of a width of a slide surface of a bed on which a reciprocal carriage installed with a tool is transferred while being supported are positioned at the same virtual plane, thereby preventing an offset error according to a relative displacement between the work piece and the tool during processing.

Abstract: A method for preparing glycidol using glycerol includes mixing glycerol with urea in the presence of at least one zinc-based catalyst selected from the group consisting of Zn(NO3)2, ZnCl2, ZnO and Zn(OAc)2 under a pressure of 0.5-10 kPa at a temperature of 100-170° C. to obtain glycerol carbonate; filtering the glycerol carbonate mixed with the zinc-based catalyst through an adsorbent including a polymer resin coordinated with amine groups to separate the zinc-based catalyst and glycerol carbonate from each other; and carrying out reaction of the glycerol carbonate separated from the zinc-based catalyst in the presence of an anion alkali metal salt catalyst that is Na, K, Rb, Cs or a mixture thereof containing at least one anion selected from the group consisting of Cl?, Br?, I?, NO3?, NO2? and acetate under a pressure of 0.13-6.67 kPa at a temperature of 140-250° C. to obtain glycidol.

Abstract: An object is to mix multiple liquids sufficiently and then nebulize the mixed liquids while maintaining the nebulizing efficiency. A nebulizer includes a first inner tube disposed inside an outer tube and having therein a first sample passage through which a first liquid sample flows, a second inner tube disposed inside the outer tube in parallel with the first inner tube and having therein a second sample passage through which a second liquid sample flows, a membranous member disposed with a gap between the membranous member and sample outlets formed at respective ends of the inner tubes. The gap forms mixing space in which a gas passing through a gas passage converts the first and second liquid samples flowing out of the sample outlets into droplets and mixes the droplets and the membranous member has multiple holes through which the mixed liquid samples pass along with the gas.

Abstract: A rare earth magnet, which is represented by a neodymium magnet (Nd2Fe14B) and neodymium magnet films with applications in micro-systems. A method for producing a rare earth magnet, comprising: (a) quenching a molten metal having a rare earth magnet composition to form quenched flakes of nanocrystalline structure; sintering the quenched flakes; subjecting the sintered body obtained to an orientation treatment; and applying a heat treatment with pressurization at a temperature sufficiently high to enable diffusion or fluidization of a grain boundary phase and at the same time, low enough to prevent coarsening of the crystal grains, (b) thick films deposited on a substrate, applying an annealing to crystallize with pressurization at a temperature sufficiently high to enable diffusion or fluidization of a grain boundary phase and, at the same time, low enough to prevent coarsening of the crystal grains.

Abstract: Disclosed are a folded chlorotoxin, a chlorotoxin variant and a folded chlorotoxin variant and their preparation technology. The folded chlorotoxin has a peptide sequence of MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2, and the folded chlorotoxin variant has a peptide sequence of MCMPCFTTDHQMARSCDDCCGGSGRGSCYGPQCLCR-NH2 and is formed by replacing serine (Ser, S) by lysine (Lys, K) in the peptide sequence of chlorotoxin. The chlorotoxin and its derivatives have potential application values in biological and medical fields and good economic and social benefits to life, health, and personalized healthcare.

Abstract: Provided are compositions and methods for treating hematological malignancies, such as multiple myeloma, in a subject by increasing levels or activity of miR-30 RNA in plasma cells of the subject.

Abstract: Disclosed are a method of manufacturing a flexible thin-film type super-capacitor device and a super-capacitor device manufactured by the same. The flexible thin-film type super-capacitor device comprises a base film which has flexibility; a separator which is interposed between the base films; and an active material which is formed on the base film. Thus, flexibility is given since thickness is very thin while maintaining high electrical conductivity and high binding property. In addition, economic feasibility is high and mass production is possible. Further, it is possible to stably and efficiently contain a highly corrosive material.

Abstract: Disclosed herein is a digital-to-analog converter (DAC) including a clock driver for controlling a clock signal to provide an inverse delay clock signal to allow at least selective adjustment of a return to zero (RZ) section; and a DAC core comprising at least two DAC units for receiving a digital input value, the clock signal and the inverse delay clock signal and providing an analog output value. According to the present invention, distortion of the output of the DAC may be attenuated and loss of the output may be minimized by utilizing the RZ technique.

Abstract: An absorbable periodontal tissue and bone regeneration material uses bacterial cellulose that has been exposed to radiation. The bacterial cellulose was confirmed to block the invasion of soft tissue in a calvarial defect in rat and rabbit models and to display excellent absorptiveness enough to contribute bone formation. Therefore, the bacterial cellulose can be developed as an absorbable periodontal tissue and bone regeneration material useful in the field of medical engineering by regulating biodegradability without using chemicals that are toxic to human and environment.

Abstract: A method of encoding or decoding coding units of a video content in a palette coding mode using an adaptive palette predictor is provided. The method includes adaptively determining a maximum size of the adaptive palette predictor based on at least one of a complexity of the video content and coding quality of the video content; and encoding or decoding the coding units of the video content in the palette coding mode using the adaptive palette predictor while limiting the adaptive palette predictor that is derived from all palette(s) of previously encoded or decoded coding unit(s) of the video content within the maximum size determined in the adaptively determining step. An apparatus of encoding or decoding coding units of a video content in a palette coding mode using an adaptive palette predictor is also provided.

Abstract: Provided is a communication method in a wireless communication system using an interference alignment. The method includes: receiving, by a first AP, a data stream by using N1 (natural number) first reception antennas, and receiving, by a second AP, the data stream by using N2 (natural number) second reception antennas, in a wireless communication system including the first AP and the second AP which receive the data stream through a transmission beam which one or more user terminals having m (natural number) transmission antennas within a given number transmit; and updating to selectively add a part of user terminals which are newly connected to the first AP and the second AP to a set of connected user terminal, and transmitting, by each terminal of the set of connected user terminal, linearly independent transmission beams by applying an interference alignment with respect to a plurality of the first and the second reception antennas for the updated set of connected user terminal.

Abstract: A video encoding method includes receiving a source video frame, dividing the source video frame into a coding tree unit, determining a coding unit from the coding tree unit, enabling or disabling a coding mode of the coding unit, determining, if the coding mode is enabled, whether to evaluate a size of a transform unit for the enabled coding mode, and determining a transform unit of the coding unit for the enabled coding mode, wherein the size of the coding unit is defined by a number (N) of samples.