Abstract: Cyclic peptides comprising a cadherin cell adhesion recognition sequence HAV, and compositions comprising such cyclic peptides, are provided. Methods for using such peptides for modulating cadherin-mediated cell adhesion in a variety of contexts are also provided.

Abstract: A biosensor apparatus for detecting a binding event between a ligand and receptor. The apparatus includes a biosensor surface and surface-bound two-subunit heterodimer complexes composed of first and second, preferably oppositely charged peptides that together form an &agr;-helical coiled-coil heterodimer. The-first peptide is attached to the biosensor surface, and the second peptide carries the ligand, accessible for binding by a ligand-binding agent. Binding of anti-ligand binding agent to the surface-bound ligand is detected by a suitable detector. A ligand-specific biosensor surface can be readily prepared from a universal template containing the first charged peptide, by addition of a selected ligand attached to the second peptide.

Abstract: The invention provides a means of identifying compounds which modulate SHP biological activity in neurons and which thus regulate neuronal cell death.

Abstract: Agents that inhibit the development of cancer and tumor growth are provided. Such agents comprise a classical cadherin CAR sequence HAV within a cyclic peptide ring, and may be used to prevent or treat cancer.

Abstract: The present invention relates to a human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO:1); and AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDAKWKMWRKTT (SEQ ID NO:4). A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence coding for a sequence of the present invention together with a DNA fragment to form a vector capable of expression of the DNA fragment; b) introducing the vector of step a) into mammalian cells in vitro.

Abstract: The instant invention provides a method for detecting the presence of a restorer gene in the nuclear genomic DNA of a Brassica plant comprising the use of a probe/primer comprising the sequence of the Brassica glyceraldehyde-3-phosphate dehydrogenase (SEQ ID NO: 1) or a sufficient hybridizing fragment thereof.

Abstract: This invention describes novel purified and isolated nucleic acid molecules or the fragments thereof, extracted from nematode or arthropod pests or recombinant, which encode P-glycoprotein homologs and regulate resistance to the macrocyclic lactone compounds. The invention further relates to the new P-glycoprotein homolog expression product of these nucleic acids. Also described herein are methods for detecting the gene encoding for resistance to the macrocyclic lactone compounds in nematode or arthropod pests which comprise comparing the nucleic acids extracted from a pest specimen to the nucleic acids encoding for resistance and the nucleic acids encoding for susceptibility to the macrocyclic lactone compounds.

Abstract: The present invention relates to an Extract of Echinops spinosus L (Asteraceae) and organic solvent soluble fractions of the extract that may be used in the treatment of cancer.

Abstract: The present invention relates to lower urinary dysfunctions and more particularly to an electronic stimulator implant and method to improve bladder voiding and prevent bladder hyperreflexia. There is provided an electronic stimulator implant for which comprises a tonicity signal generator generating a tonicity signal which prevents bladder hyperreflexia combined with a voiding signal generator generating a voiding signal for voiding the bladder. The implant is connected to an end of an electrode, and the second end thereof is connected to a sacral nerve. When the voiding key (or switch) is activated, the voiding signal is generated which activates detrusor muscle contraction, causing bladder voiding. The voiding may be achieved without dyssynergia, by activating detrusor muscle contraction without activating external urethral sphincter contraction. The tonicity signal may be provided intermittently. The implant may be activated by a manually activated external controller.

Abstract: A method and apparatus for precipitating manganese from acidic sulfate solutions, and more specifically from zinc leach solutions, without removing zinc. A zinc- and manganese-containing solution is treated with an SO2—O2 gas mixture at the appropriate pH and temperature, thereby causing manganese to precipitate as a trivalent and/or tetravalent manganese hydroxides and/or oxides that report to the leach residue or are removed separately from solution by solid/liquid separation. These trivalent and/or tetravalent manganese compounds may be used as oxidants in other parts of the leach circuit.

Abstract: A transmission mechanism for transmitting motion with a uniform speed transmission factor between first and second moveable elements comprises a set of cams adapted to rotate with the first moveable element about a revolving axis, and corresponding arrays of spaced-apart rollers connected to the second moveable element for movement therewith. The cams cooperate in relays with the corresponding arrays of spaced-apart rollers to continuously communicate motion between the first and second moveable elements. The cams are in rolling contact with the corresponding arrays of rollers, whereby torque and force transmission can be performed smoothly. Furthermore, the transmission mechanism allows for the reversal of both the direction of the input speed and the roles of the first and second moveable elements.

Abstract: The invention relates to a foliar saline spray solution for selective control of noxious weeds such as ragweed, poison ivy, dandelion, clover, bedstraw, wild parsley, millet, thistle, English daisy, plantain, ground-ivy, and knotweed. The invention also relates to a method for selective control of noxious weeds. In accordance with a preferred embodiment of the present invention, the solution comprises 8% to 12% weight to volume of a specific salt such as sodium chloride. The solution may further comprise an adjuvant such as a non-ionic surfactant.

Abstract: The present invention relates to methods for enhancement of naturally occurring cytoplasmic male sterility and for restoration of male fertility and uses thereof in hybrid crop production. There is also disclosed a method for restoration of male fertility to cytoplasmic male sterile plants; which comprises the steps of: a) introducing into the nucleus of a plant cell a gene construct essentially consisting of a sequence encoding a mitochondrial transit peptide fused upstream of and in frame with an edited form of a normal mitochondrial gene that is co-transcribed with an unusual CMS-associated mitochondrial gene; b) selecting for plant cells that have acquired the gene construct in step a); and c) inducing regeneration of selected plant cells to produce a mature plant.

Abstract: Cyclic peptides and compositions comprising such cyclic peptides are provided. The cyclic peptides comprise a cadherin cell adhesion recognition sequence HAV. Methods for using such peptides and compositions for modulating cadherin-mediated cell adhesion in a variety of contexts are also provided.

Abstract: A hydrogen storage composition has a hydrogenated state and a dehydrogenated state; in the hydrogenated state the composition comprises a metallic hydride having a metallic component which reversibly forms the hydride and a metallic heat transfer medium in intimate contact with the hydride which transfers heat to the hydride for dehydrogenation; in use hydrogen is liberated from the composition with transfer of heat to the heat transfer medium, the hydrogenated state may be regenerated by exposing the composition in a dehydrogenated state to hydrogen gas. In this way a source of hydrogen gas is provided which source may be regenerated.

Abstract: Modulating agents comprising cyclic peptides, and compositions comprising such modulating agents are provided. The cyclic peptides comprise a cadherin cell adhesion recognition sequence HAV. Methods for using such peptides and compositions for modulating and/or directing neurite outgrowth in a variety of contexts are also provided.

Abstract: Disclosed is substantially pure recombinant human alpha-fetoprotein produced using prokayote and insect cells.

Abstract: Pulmonary edema in the lung is detected by exposing a lung under investigation to infrared radiation, especially near-infrared radiation; measuring the reflected radiation scattered by the lung as a spectral response to the presence of water in the lung; comparing the reflected radiation with calibrated values and evaluating occurrence of pulmonary edema from the comparison.

Abstract: Cyclic peptides and compositions comprising such cyclic peptides are provided. The cyclic peptides comprise a cadherin cell adhesion recognition sequence HAV. Methods for using such peptides and compositions for modulating cadherin-mediated cell adhesion in a variety of contexts are also provided.

Abstract: The present invention relates to an improved method of treating paper products in order to enhance various properties thereof, and more specifically, including the step of treating the paper with superheated steam. In a method of treating paper during a papermaking process from wood pulp, the step of drying the paper in superheated steam in order to improve certain physical characteristics.